Identifiers and Description

Gene Model Identifier

Contig12201.0.g41

Standard Name

POLR1E

Aliases

Contig12201_0_g41

Description

A49-like RNA polymerase I associated factor

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam06870 ) A49-like RNA polymerase I associated factor

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004859900.00000000019994075865167896hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12201.0.g41(coding)
ATGACATCTACAGGTCAAAGCACTAACTTTAAGACTGTGAAGACTTGTGACAAAGATCAC
GCAGACTCAAACTTTTTGACAGAGCCGATTATAGCCAGTTTTCCAAATAACATGCCCTCT
GGCTAACATCTCCAAAAACTCACTTTCGCAGCCTTTCAACAAGAGAAGGACAACTAGGGA
AAGCAGTAAAATAGATTGAAGCGCAGACTTATTAAGGCAGAGTACAAATAAGGGTCCTAG
GCAGCTGGAGGAGTCAGATATCAGGGAAAGAACCATGGCCATGATATCAACCCCAAGGAC
CAAGCAAGTGACTACTATATGGGGGTTTTTGTGCCAGAAGAGAACAGAGTGTTTATGGTT
CCAGTTTCTACATGCTACTAATTTAATTAGGAAATCCAGAAGTTCACTGAGATATACAAT
GGAGAAGAGGACAATGAAGCTCTCAAGTCGATGAATTACATGAATCAAAAGCTTCAACTG
GCAAATGCGTTTGGTACAAATTAATCAAGAAAGAAGATTACATCCATGCTCACAAATATG
GTTGAAGACGGTGGAATTAATCAGAAAAATGATAAGGGAGTGAGGGATCACAGACTAGCA
GATAAAGCCCTTTTAATTAGCAAAGATCAAGATGTTCTTAAGAGTGAGCTCCTTAGTGCC
TCAAAAAGAAGATCAGACCTCTACTCTAGAGATCAGCTACTCCCAGCAGAGGTATTAGAG
CAAGTAGCCTATAAAAACACCTACAATGCTTTACAGAATGATAATGAAGAGGCACTTAAG
CAATTAATTTTAAGTCCTCTTGCTGGACATTTAGTCAGAAAAGTCTATTCAAGATTCGAA
CAAATCGCCACTAAGAGCGAGAAAAAATTATTGCTTAAGGCTTGCATTTATTTGGACTCA
TTGATAACATTCTATAGATTGCCTTAGAACCTTGACCAGTCTCTGGAGGTGTACTCATCT
AAAGCCAACATCCCTCTTCCACTCTTTGAGAAACTAGTCGAGAAATTCTCAACAGTATCG
TTCAAAAACTAGAGCATGCTGATGAATCACGAGAGTGTAGACAGCTCATTGAATAACTCA
AGTGTAGCCAATTAGTACAAATATACTAAGAGCAAGGAGTAGACAAAGATGCTTATTTGC
CACGTGATAGGAATCAATGCTATTTTGAACTAAGGTGGTAAATTCAAAGCCAGTCACATC
GCAAGAGTGCTTAAAAAGGAGGTCACTGATTTAAAGAGCTACTTCTAAGAACTTGGATTA
GATTACTCTGTTATCAAGGAAGATGGAAAGGACGATATTCTAGTATCAACAGTAGTCAAC
GACAAGCCAGAGTACCAAAGTGGTGGAAAATAAAGCTTTCATAAAGACAGAAAAGACTCT
GGGGCAGGTAGCACAAAGAGTGGTAAATCCAGTGCAAGCAAGAAGAGCGAGACAACTAAT
ACATCCAACGACTAAATAGGTGTCAAGAGAACTAAGAGACAGTAGAAACATGATCAAGAA
TTAGCTAGATTAGCTGCTCAAGTTCCTGATTAGCAATGA


>Contig12201.0.g41(protein)
MTSTGQSTNFKTVKTCDKDHADSNFLTEPIIASFPNNMPSGQHLQKLTFAAFQQEKDNQG
KQQNRLKRRLIKAEYKQGSQAAGGVRYQGKNHGHDINPKDQASDYYMGVFVPEENRVFMV
PVSTCYQFNQEIQKFTEIYNGEEDNEALKSMNYMNQKLQLANAFGTNQSRKKITSMLTNM
VEDGGINQKNDKGVRDHRLADKALLISKDQDVLKSELLSASKRRSDLYSRDQLLPAEVLE
QVAYKNTYNALQNDNEEALKQLILSPLAGHLVRKVYSRFEQIATKSEKKLLLKACIYLDS
LITFYRLPQNLDQSLEVYSSKANIPLPLFEKLVEKFSTVSFKNQSMLMNHESVDSSLNNS
SVANQYKYTKSKEQTKMLICHVIGINAILNQGGKFKASHIARVLKKEVTDLKSYFQELGL
DYSVIKEDGKDDILVSTVVNDKPEYQSGGKQSFHKDRKDSGAGSTKSGKSSASKKSETTN
TSNDQIGVKRTKRQQKHDQELARLAAQVPDQQ