Identifiers and Description

Gene Model Identifier

Contig22041.0.g30

Standard Name

POLR1C

Aliases

Contig22041_0_g30

Description

RNA polymerase Rpb3/RpoA insert domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01000 ) RNA polymerase Rpb3/RpoA insert domain
  • ( pfam01193 ) RNA polymerase Rpb3/Rpb11 dimerisation domain
  • ( pfam12838 ) 4Fe-4S dicluster domain
  • ( pfam13237 ) 4Fe-4S dicluster domain
  • ( pfam13187 ) 4Fe-4S dicluster domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000942109.997540506729281e-98RNA polymerase Rpb3/Rpb11 dime
risation domain...
SGDYPR110C9.995417076252815e-72RPC40 SGDID:S000006314, Chr XV
I from 746835-745828, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22041.0.g30(coding)
ATGGACGGTAAAAAATCAGCTAGATCTAAGTCAGGAACTAAGTAATCTTCAGCTAAGAAG
CAATAGGAAGACATTTCATCGGTATCTGAAGATGAGAAAACTTTTGTAGATAAAATGAAA
AAGAGAGCTATAGTCAAGACTTATGGTATCGACAATGCTTCCACCTTTGAACACCCAGCT
TCATTTAGTGCCACTACCAAAGAGTTGGACAAGGTTAGCTTGAAGGACTTTATCGAGAAC
AGCAACATTGAGATTTTGAAGTTAGATGACGAGGAGATTATTTTCGATTTGATAGGTGTT
GAGCCTCCCCTTGCAAACGCTCTTAGACGTATTTTAATCGCAGAGATTCCAACAATGGCC
ATTGAGAAAGTTAACATGTGGCAGAATACATCCATCATTCCAGATGAAAATTTAGCACAT
AGAATGGGACTTATCCCTATTAAAGCGGATCCAAGGCAGTTCGAATTCCATGAAAAGAGC
ACTCTTGAGAACGACTAAGGTGAGCAACAAGACACATACACAGAGGATGACAGTTTGAGA
TTTAAGCTTCATGTGAGATGTACTAAGAAAGACCCAAGAGCACCAGTTATCATCAATAAT
ACAGTTGATGAGGAGAAATTATACAACAATGCTAATGTCTTGTCTGGTTAACTAAAATGG
ATTCCAGTTGGCAATTAAGCATAAAAATTCGGCGTTGATGGAATTAAGCCACTCTTCGAT
GATATATTGATCGCTAAATTAAGACCTGGCCAAGAAATTGAAATGGAGTTAATCTGTGAG
AAGGGAATCGGTAAAACTCACGCCAAATGGTCTCCAGTGTCAACAGCATTCTATAGATTA
GTTCCAGATATCAAAATTACTCAAGACATTATGAATGAGGAAGCAGTTGAATTAAAGAAC
CTATGCCCTACTGGTGTTTATGATATTGAAGACCTCGGCAAGAAAGGAAAGAGAGCAATA
GTTGGAGATGTGAGAAAATGCACAACTTGCAGAGAATGCATCAGACCAGAGAAATTCAGA
GAGAGAATAGATCTCGGTAAAATCAAGGATAGATTTGAATTTCATGTTGAATCAGTTGGC
ATACTCCCACCCGAGGTACTAGTCATCGAGGCTCTCAAGAAGCTTAAGGAGAAGGCTTAA
TACTGGTTGGAAGTACTCGATTAAGACAACGAAGTCGACGAAGACGATGAAGCAACTACC
TAAAAGAGAAAGAAATGA


>Contig22041.0.g30(protein)
MDGKKSARSKSGTKQSSAKKQQEDISSVSEDEKTFVDKMKKRAIVKTYGIDNASTFEHPA
SFSATTKELDKVSLKDFIENSNIEILKLDDEEIIFDLIGVEPPLANALRRILIAEIPTMA
IEKVNMWQNTSIIPDENLAHRMGLIPIKADPRQFEFHEKSTLENDQGEQQDTYTEDDSLR
FKLHVRCTKKDPRAPVIINNTVDEEKLYNNANVLSGQLKWIPVGNQAQKFGVDGIKPLFD
DILIAKLRPGQEIEMELICEKGIGKTHAKWSPVSTAFYRLVPDIKITQDIMNEEAVELKN
LCPTGVYDIEDLGKKGKRAIVGDVRKCTTCRECIRPEKFRERIDLGKIKDRFEFHVESVG
ILPPEVLVIEALKKLKEKAQYWLEVLDQDNEVDEDDEATTQKRKK