Identifiers and Description

Gene Model Identifier

Contig2863.0.g30

Standard Name

POLR1B

Aliases

Contig2863_0_g30

Description

RNA polymerase Rpb2, domain 6

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00562 ) RNA polymerase Rpb2, domain 6
  • ( pfam04563 ) RNA polymerase beta subunit
  • ( pfam04560 ) RNA polymerase Rpb2, domain 7
  • ( pfam04565 ) RNA polymerase Rpb2, domain 3
  • ( pfam04561 ) RNA polymerase Rpb2, domain 2
  • ( pfam06883 ) RNA polymerase I, Rpa2 specific domain
  • ( pfam04567 ) RNA polymerase Rpb2, domain 5

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010757809.997093137033517e-262DNA-directed RNA polymerase, b
eta subunit fam...
SGDYPR010C9.997093137033517e-262RPA135 SGDID:S000006214, Chr X
VI from 581196-577585, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2863.0.g30(coding)
ATGTCTAAAGAGAGAAAGGTAAACGATAGAGTTAGATTCACAGAGAAAACTCTTAGTGTA
CAACTTAAAAATGCAGCTAAGCATCATATTGAGTCATTCGAGTATGCCATTGAGCAGTGC
TTACCAAGGATTTGTCAAAATTTACTAGCTGCTGAGTTAAGTGCTCCAACTGAAGCAGAG
ATCGCAAGAAACCCAAGTGCTAACAAAATTTAATACCCATTTAAGAAGATGCTTATATGG
TTTGAGAATTTCCAATTGAGAAAGCCAATTAGATAAGATCAATCGACAGGCCTCATCAGT
CTATCTCAGAGTTCTTAAGCAGCAGCAGGAGGAGATGGAGATAAAATCTACCCAAGTGAA
TGCAGAATTAGATCTCTCACATATTCAGCACCTCTTTATGCTACCATTGCTAGAAAGATT
GATAATGAGCCTGAAGAAAAGGTCACTGTGCCACTTGGTGATATCCCAGTTATGATTAGA
TCATCTAACTGTCATTTGTATGGATTGACTGAGGAGGAATTAGTTAAAAAGCACGAGGAT
ATGGCTGAGTTCGGAGGCTATTTCATTATTAATGGAAATGAGAGAATCGTTAGAATGCTT
ATTATGACAAAAAGAAACTACCCAGTTGCATTTTCTAGACCAACCTTCATTAACAGAGGC
AAGCTCTTCACACCTTTTGCTGTTTAAATGAGATGTGTGAGAGATGACTTATTTGCATAG
ACTCTCACTCTTCATTATCTTAGCGATGGTAATTGCTCAATGAGGCTTATATACTAAAAG
CAAGAATTTTTAATTCCAGCTTATGTCATTCTTAAGGCTTTAGCAGATGTTACAGATGCA
TAAATTTATAATAAGCTTGTCAAAGGTTACTTCAAAAATAGATAAATAGGAGATAGAGTT
GAAGTTTTGCTTCAAGATGGTAATAAGTTGTGCTTATACTCATAAAACTAATGTTTAGCC
TATCTTGGTTCAAGATTTAGAATGGCTTTAATCGGTGTTCAATCAGATATGAGTGACATA
GATGTTGGTAACTTTTTTATCTAAAGACATCTATTTGTTCAAACTAATAATTACAAAGAT
AAGTTCAATACTCTCTGCATAATGATTGAGAAGTTATATGCAGTTGTGGCCTAAGAGTGT
GAACTAGATAATCTCGATTCACCATCTAACTAAGAAGTTCTTTTGAGTGGTCATTTATAT
GCCTCCCTATTAGCTGAAAAACTTCAGGATTTATTGATTGGAGCTAAAGCTAAGATAATC
AGAGATCTGAGAAATCCCAATTTTGACAGACAATAAATTAGAAACCCAATTTATATGAAA
AAAATGATAGACACCCAAGTATCAGTAGGAAAGAAAATGGAACACTTCTTAGCTACAGGG
AATCTGATATCAAGAACTAATTTAGATTTAATATCAATCCATAGAGGATAATATTTCGCA
GAGATGAAAACCACAACTGTCAGAAAGTTGCTTCCAGAAGCTTGGGGATTCCTTTGCCCA
GTACATACTCCAGATGGTGGTCCCTGCGGTCTTTTAAACCATATTACTTCATCTTGTATT
CCACTTGCCAAAGAAGATGGCTTACTTTGCAGACAAGGTGAAGCTTTGAAGAACTTTAAG
AGTCTACTAGCCTAATTGGGAATGAATCCTATATCAAGTGATTTTGGACTTATTTATCCT
TACAAGTTTTTACCTATTCTTCTCGATGGTGTATTATTGGGATATGTAGATCCAGAAGTT
GCTCCTCAGCTTGTTAAATCGTTAAGAGCTCTTAAAATTTAACAAAGTAATACCAACCAA
TTTTATGAAAGTGTACCAAAAACTCTTGAAGTATCTTACTTAGCCCCAACTTTCCCACCA
GAAGAAGCTAGTGATAATCCCGAGACATAAGGCCAAACTAACAAAAGAGGAACAAAGAAT
AAGTTCTTCCCTGGTATTTTCTTAGCATCATCTGTATCTAGATTTGTAAGACCAGTCTAA
AATTTAGAAGTTGGTGGAGTAGAATGGATTGGACCTTTAGAACAAGTTAATCTTTCTATA
GCTTGCCTTGAGGAGGATATTAGAAGCGACACTACACATTAAGAGATAGACCCAATAAAT
GTTTTGAGTATGATTGCCTCAACAATTCCTTTTGCAGATTATAACCAATCTCCAAGAAAC
ATGTATCAGTGTCAAATGGCAAAATAAACTATGGGAACTCCTTATCACAATCATCCTTAT
AGAATGGATAACAAAGTATATAGAATCCTCTTCCCTCAAGAACCTTTAGTGAGAACTGAG
AACTATAACAATTACGATTTTAGACAATATCCAAGTGGAACCAATGCAGTCGTTGCAGTT
ATCTCATATACAGGTTACGATATGGAAGATGCTATGATCATAAACAAGAGTGCTTACGAA
AGAGGTTTTGGTCATGGATGTGTCTACAAATCTTACATCAAAGAAGTTAATGAGTAAGTG
ATGGGTGCTTCTTCAAGCAAACAAAGATACAGGATGCTCAACTAGAACAAGTACAGAGAG
GACTAAAAGATTGATCTAAAAGAGAAAAACCTTGACACTGATGGAATTCCAAGCATTGGA
CATCAGCTCACTCATGGAAGCCCAGAGCTATGCACATATGACACTGTTTTGGGAAAGCCT
AAATATGTGAGTTTCAAAGATAATGAACCAGCTAGAGTTGAAAACGTAAGATTAATGGGA
GATGAAAAAGGCTCAGCAAATAACGTAAACATTGGCTATACTATAAGATACGAAAGAAAC
CCAGTTATTGGAGATAAGTTTAGTAGTCGTCACGGTCAAAAGGGTGTGCTCTCAGTTCTT
TGGCCCTAAGAAGACATGCCTTTTACTGAGAGTGGAATCTCTCCAGATATTATCATTAAT
CCTCATGCATTCCCATCAAGAATGACCATTGGAATGTTGGTAGAATCAATTGCTGGTAAG
TCTGGTTCTAACACAGGAGAGTTCAAATAAGTAAAGACATTTGAGAAATACGAGGATGAT
GATGTGGTCTAGTACTTTGGTCAGGAACTCCTAAAGCAAGGGTATAATTATTATGGAACT
GAGACAATGTACTCTGGAATCTTTGGAGATCAAATGAAGGTTGATATCTTCATTGGTGTT
GTCTATTATCAACGCCTCAGACATATGGTTTCAGATAAGTCTTAAGCTAGAGCCACAGGT
CCTTATGATGTCTTAACTCATCAACCAGTGAAGGGAAGAAAGAAGCAAGGAGGTATTAGA
TTTGGAGAGATGGAAAGAGACTCACTTTTAGCTCATGGAGCAGCTTTCTGCTTGAATGAT
AGACTTCTAAAATGTTCCGATTATAGTGAGGGATATGTCTGCAAAAAGTGTGGAAGCATC
ATTAGTTGCCACTTAAATAGAGAAATTCTAAAAACCTAGAACAATATATCAGCAGACATG
AAATACGTTGTCAATGAAAAGGTATACTGTAGAGTTTGTGATGAATACGATTGCAGAAAA
GTTCAACTTCCATATGTCCTCAGATATTTAACTAATGAATTAGCTGCTATGAATATTAAA
CTTGCTTTCCATTTAGAGCCAGCTGTTTGA


>Contig2863.0.g30(protein)
MSKERKVNDRVRFTEKTLSVQLKNAAKHHIESFEYAIEQCLPRICQNLLAAELSAPTEAE
IARNPSANKIQYPFKKMLIWFENFQLRKPIRQDQSTGLISLSQSSQAAAGGDGDKIYPSE
CRIRSLTYSAPLYATIARKIDNEPEEKVTVPLGDIPVMIRSSNCHLYGLTEEELVKKHED
MAEFGGYFIINGNERIVRMLIMTKRNYPVAFSRPTFINRGKLFTPFAVQMRCVRDDLFAQ
TLTLHYLSDGNCSMRLIYQKQEFLIPAYVILKALADVTDAQIYNKLVKGYFKNRQIGDRV
EVLLQDGNKLCLYSQNQCLAYLGSRFRMALIGVQSDMSDIDVGNFFIQRHLFVQTNNYKD
KFNTLCIMIEKLYAVVAQECELDNLDSPSNQEVLLSGHLYASLLAEKLQDLLIGAKAKII
RDLRNPNFDRQQIRNPIYMKKMIDTQVSVGKKMEHFLATGNLISRTNLDLISIHRGQYFA
EMKTTTVRKLLPEAWGFLCPVHTPDGGPCGLLNHITSSCIPLAKEDGLLCRQGEALKNFK
SLLAQLGMNPISSDFGLIYPYKFLPILLDGVLLGYVDPEVAPQLVKSLRALKIQQSNTNQ
FYESVPKTLEVSYLAPTFPPEEASDNPETQGQTNKRGTKNKFFPGIFLASSVSRFVRPVQ
NLEVGGVEWIGPLEQVNLSIACLEEDIRSDTTHQEIDPINVLSMIASTIPFADYNQSPRN
MYQCQMAKQTMGTPYHNHPYRMDNKVYRILFPQEPLVRTENYNNYDFRQYPSGTNAVVAV
ISYTGYDMEDAMIINKSAYERGFGHGCVYKSYIKEVNEQVMGASSSKQRYRMLNQNKYRE
DQKIDLKEKNLDTDGIPSIGHQLTHGSPELCTYDTVLGKPKYVSFKDNEPARVENVRLMG
DEKGSANNVNIGYTIRYERNPVIGDKFSSRHGQKGVLSVLWPQEDMPFTESGISPDIIIN
PHAFPSRMTIGMLVESIAGKSGSNTGEFKQVKTFEKYEDDDVVQYFGQELLKQGYNYYGT
ETMYSGIFGDQMKVDIFIGVVYYQRLRHMVSDKSQARATGPYDVLTHQPVKGRKKQGGIR
FGEMERDSLLAHGAAFCLNDRLLKCSDYSEGYVCKKCGSIISCHLNREILKTQNNISADM
KYVVNEKVYCRVCDEYDCRKVQLPYVLRYLTNELAAMNIKLAFHLEPAV