Identifiers and Description

Gene Model Identifier

Contig17704.0.g32

Standard Name

POLR1A

Aliases

Contig17704_0_g32

Description

RNA polymerase Rpb1, domain 5

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000475509.997093137033517e-262RNA polymerase Rpb1, domain 2
family protein
SGDYOR341W9.997093137033517e-262RPA190 SGDID:S000005868, Chr X
V from 960987-965981, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17704.0.g32(coding)
ATGTTTAAGCTAGACAACGAATTGATAAAGGACCGATTTGCTGCAACCTCTTTCAGTTTT
TACACTGAGCAAGAGATTGAGAAATTGGCTGTGAAACAAATTCTTAATCCTACTGCTTTT
GATCATTTGAATAATCCCACAAATGGAGGTATTTATGATAAGGCTTTAGGAGTCTCACCA
TTCGATCATCGTGCATAGTGCGTCACTTGTGGACTTGACTGCTAGTACTGCCCAGGTCAT
TTAGGCTATATTGAATTAACTGCACCCTGCTATAACCCATTCTTGATCAACCAGCTTTAC
AAGCTATTAAAGTCTAAATGTATCAAATGCCACAGAATAAGAATACATCCAAAGAAAATA
GACATCTACATTCAATGTCTGCAACTTATAAAATCAGGACAAATTGTAGGCTCTCAAGTA
TTAAAGAACTACTTCTTAAATGCAGCAAAAGAGACACTTTTGCTTACTGATATAAATGCA
GATGCTAAAAAGCTTGCCAAGCTCAGATAAGATTTAGACAAAATGCTATTCTTTGATGAA
AGAGGAAAAGATAAAAGCGTGAAGGTGACTGTAGATCCAAATGACTACTCCTCTTACTTT
TAAAAGATTGATTAAAAGTTCAACAAACTTAAGACTGAATATGAAGATGATTTGATAAGA
ATGTTTGAAGAGTATACTTCTTATGATAAGGATGATTTGATATGCCACACATCAATCTTA
CAAAAGACACTAAAAGAATTCACTCATGAGATTTGGTCTTCTGTCATATCAATCACTTGC
CCTCATTGTTAGGAAAAGTCTCCATCATTCAGGAAAGATGGCTATACTAAATTCTTCATG
AAACCTCTTTCTGATAAAATTAAGAATTAGATGAAGCAGTAAGATAGATTGACAAAGGGT
TCATCTAAGCATTCACAAAAAGATACTGACATAGAAGGCTTTGATATCATAAATGATGCT
TCAACTACAGGAGCACTTTCCAGAAAAGAATCACATAATGATCACACAACTGTTATTTCC
TCTTAAGATTAATACTCTTAATCAGGAGTGAATTTTGACGATGAGGAGGAGGAAGAGGAT
GACGATCTCGAAAATATGACTCATCAGAGATTATTATGTTAAAATGAAGTCCAAGACCAC
TTAATCCATATGTGGAGAAATGAAAAAGCTCTTTTAGATATTATGTTTGGTAGATTCTAT
CCAGTTGAGGATGGCTAACCATTAGAGAATGATTCATTAGGTCCTTAAATGTTTTTCTTG
AAAAAACTTCTCGTTCCACCTAATAGATTCAGACCAGAGAGTTAAGGAGCTTTTGGAGGT
GCTGGCGGAGGTCAAGGTGACAAAGCTTATTTACACGCTCATAGTGCCATGGTTCAAAAG
ATTCTTGTCAATAATTTGGCATTAAAAGATGCCATTCTTCATTAAGATCAACTAAGGCAA
TAGACTGGCAGTCAAGATACAAAAGCTAGTAATGATGTCACTCAAAAATGGATCTCACTT
CAAGATTCTATTAACACTTTTATGGATTCATCAATGGCATAAAAGACAGCAGATAAAGAA
CAAAACGGAATCAGGTAGTTGCTTGAGAGAAAGGAAGGTATGTTTAGAATGAAAATGATG
GGAAAGAGAGTGAACTACGGAGGCAGAAGTGTTATCTCTCCAGATCCATATATCACTACA
GATTAAATTGGTGTCCCTATATTTATGGCAAGAAGATTAACATTCCCTGAATCAGTAGCT
GAGGTAAATGCTGAGCACTTAAGAAAATTAGTCATGAACGGACCCAAGTAACATCCAGGA
GCTAATATGATAGAAGACGAAGAGACTGGAGTTAGAACTAACCTAGAATCAATGAGCTTT
GATTAGAGAAGAGGTCTTGCTCAATTGTTGACTGTTGGTAGAAAAATTGTATATCGCCAT
CTCAACACTGGTGATGTACTTTTGGTAAACAGATAACCAACTCTTCACAAGCCAAGTATT
ATGGCACACATTGCAAGAATTCTCCCCAAAGAGCAAACCATAAGAATGCATTACGCTAAT
TGCAGTACTTACAATGCAGATTTTGATGGTGATGAAATGAATCTTCATTTCCCATAAAGT
TATTTAGCTTGTTCAGAAGCATATAAGTTAATGGCAACTCATAAGCAATACATAGTGCCT
ACTAGTGGAAAACCAATTAGAGGACTTATTTAAGATTCAGTTGTTTCAGGAGTGTTCCTT
ACCTCAAAAGACACTTTCCTTACCAAAGAGACCTATCAACAACTAGTTTATGTCGGTTTG
AGAGAGCTTATTGAAGAAGATAAAATTGGGAAAATATTTACACTTGCACCTGCTCTCCTT
AAACCAGTCCCAAGATGGACAGGTAAGCAAGTCATTTCAACAATCATTAAGAACATTGTC
AACCAGGAGATGGATTACAAAATTAATAATATTACTGGATTAAATTTGGACTCAAAAGCA
AAGCTTTCACCCAAGGAATGGGGTTCAATTGGTCAAGAGGAAGGAGATGTTGTTTTTAGA
GATAACGAACTTTTATTAGGAACTCTAGATAAAAATCAATTTGGTGCTTCTGAGTTTGGT
TTAGTGCACTCTTTCTATGAAATTTATGGATCCGAAAAAGCTGGTGAGCTCTTAACATCT
CTAGCTAGAATCTTTACTGTATTCCTATAAATGCACGGCTTTACCTGTGGCTTAGAGGAT
CTTATGATTACTCCAGAGTTCAATAAACAAAGAAGACTGATTATCGAAAATGCACATAAG
GAAGGTATTGAGGCTGCAGCTAAATTCTGTGGAATTAAGAACTATATTGCTAAAGAATTC
AACTACTCAAATAGAATCGTCTATCAATCTGGAAAGAACAAAATTGACTAGGATATTGAA
AGATTCACAAACATGGCTGTTCCTGAGAATCCATTCAAAAACAAGAAAATCATTCAAGAA
GATGACCCTATAAGAAAAAGACTAGAGGAAAAAATGAACTCAGCCGATGATGTTTAAGCC
TTAGATGCTGAACTTGATAACGTTATGAGAAGCAAAATGAGTCAGGCAACCAGTCAAATT
TTGAAGATCTGTATCCCAGACGGTCTAGTCAAAAGATTCCCAAGAAACAACATTTCAGCT
ATGGTCTTGACAGGAGCAAAGGGAGGTCTAGTTAACATGACTCAAATTTCTTGCCTTTTA
GGGCAATAAGAACTTGAAGGCAAACGTGTTCCTAAGATGCAAAACGGTAAGACATTGCCT
TGCTACTTACCATATGATCCAAATCCAAGAAGTTCAGGTTATGTTACAGATAGATTTATT
AGTGGATTAAGACCATAAGATTTCTACTTCCATTGTATGGCTGGAAGAGAAGGTCTTATC
GATACTGCAGTCAAAACTAGTAGAAGTGGCTATCTCCAAAGATGTTTGATTAAATAGTTA
GAGTCATTAGTGGTAAATTACGATATGACAGTAAGAGATAATGATGGCTCAATCGTCCAA
TTCCTATATGGTGAAGACGGAATCGATGTAATGAACTCAAAATATCTTGAAAAGTTTGAC
TTTTTAGAGAAGAATTTTACTTCTCTTATCACTACTTATAATGGTTCTGAGATCATGCAA
AGAGTCGATAGAAATGCTGTAGATGATTATAAACACAAAGCAAAGAAAGTTCTCAAGAAA
ATGAAGAAGGAAAATCCAAGTATTACTAATCATGAATTAAAGAGATACAGAGGTGATCCA
GCAATATCTTTATATCATCCTTTGAAGTACTTTGGATCAATTTCTGAGAAAATGGACAGT
AAGCTCAAATCTTACCTCGAAAACGATTCAATGTAATAACTAACAGCAAAGATGGGTAAT
ATGGCAATGAAGCAAAAGTTTGAGCCAATAAAGGGAGATACCTTCAAGAAAATGTATTTC
CTAAAGTACATGAAATCAGTTGTCCATCCTGGTGAAAATGTTGGTACTATTGCTGGTCAG
TCAGTCGGAGAGCCCTCTACTCAAATGACCTTAAACACTTTCCATTTGGCTGGTCATGGT
GCTGCCAATATGACTTTAGGTATTCCAAGATTAAAGGAAATACTTATGACCACTCCAACT
AACATCAAGACCCCAAATATGATTGTATACTTCAGAAGAGAACTCTCTCTCATTAAAACT
GAAATGGAGATGTACGCTAACAGATACAAGAGAATTAAGCTCTGTGATGTAACTAAAGAA
CTTAAAGTCACTCAGGAAATCGCTACTGATGATTCAGGAAACATCCTTAGATTGTATAAT
ATCACTCTTTAAATCGAGAGTGTGAGAAGAATCGCTAAGTACCTAGGACTAGAGTTCAAG
GATTTGGTAAAGGTATTTAGTGATCAATTCATCCCACTGCTTATGGCTGAAATTCTTAAA
TAACTTAAGAAAGCAAGTTAAGATTAAGGATAAGACGATGTCTAGACCAACCCAGGCACT
AAATCTACTTTGAATGCTTCAAAGATTACTAAAAAATTCAAGGCAAATGGAGATGTTGAT
GAGGAGTTTGATGTTGATAATGAAGATGAAATCGTCAAGCAAGCTAGTCAGAAGAGCAAA
AGTAGTGTAAAAGGCGACATGAATGTTGATGAGGATGAAGATGAGAATGAAGATGAAGAT
GATATGATGGATATCGATGGAGTTGAAAAGAAAGCCAAAGACATCAAGGGATACGAACAA
GAAGACGAGGAGGACAGAGACTTCCTTAGAAGATCTTCTAATAACAGATCAGAGTCAAAA
CAAAAAGAAGATGAGGAAAAGAACATGAACTATTATTGCAACATTTTAAGAGAAAAGTTT
TCAAAGTATCAAGGTTACATTAGAAAGATTGGTTATGAAGACGATAAATCAATGACCGTG
ACTCTTGGGTTCCCATTACAATTCAAAAAGATTCTCATGCTCACTGTAGCTGAATAAATT
TTGGCAAAGGTGTTGGTTAGATCAGTTTCTGGAATTGATAATTGTATTCTTGTTACACCA
GACAAAGCTAATGAAGAACCATACTTACTCGTCTAAGGTCTTAATTTTGAGGCATTCTAC
AATGATCAAGATATTTTTGACGTAAATAGAATATAATCAAACGACATCTGGCAAATCATG
AAAAAGTACGGTGTTGAAGCTGGTTGTGCTAATCTCGTCAAAGAAGTCAGATAAGTCTTC
AACATGTATGGTATTGAAGTAAACTACAGACATTTGAGTTTGATTGGAGATTTCATAACA
AACAATGGAGAGTACAGAGCCTTCAATAGAATCGGAATGGAAGAGAGCAGCTCTCCTTTC
TTAAAAATGAGTTTTGAAACCACAATGAAATATCTCGTGGCAAGTTGCGTATAAAAAGAT
ACTGATGACCTTAGCACTCCCGCATCTGCCTTGGTTCTTGGTCAAGTACCTAAAGTGGGC
ACAGGTATCTTTGATATTATTCATGATCCAGATTACGCTCTCGCTTGA


>Contig17704.0.g32(protein)
MFKLDNELIKDRFAATSFSFYTEQEIEKLAVKQILNPTAFDHLNNPTNGGIYDKALGVSP
FDHRAQCVTCGLDCQYCPGHLGYIELTAPCYNPFLINQLYKLLKSKCIKCHRIRIHPKKI
DIYIQCLQLIKSGQIVGSQVLKNYFLNAAKETLLLTDINADAKKLAKLRQDLDKMLFFDE
RGKDKSVKVTVDPNDYSSYFQKIDQKFNKLKTEYEDDLIRMFEEYTSYDKDDLICHTSIL
QKTLKEFTHEIWSSVISITCPHCQEKSPSFRKDGYTKFFMKPLSDKIKNQMKQQDRLTKG
SSKHSQKDTDIEGFDIINDASTTGALSRKESHNDHTTVISSQDQYSQSGVNFDDEEEEED
DDLENMTHQRLLCQNEVQDHLIHMWRNEKALLDIMFGRFYPVEDGQPLENDSLGPQMFFL
KKLLVPPNRFRPESQGAFGGAGGGQGDKAYLHAHSAMVQKILVNNLALKDAILHQDQLRQ
QTGSQDTKASNDVTQKWISLQDSINTFMDSSMAQKTADKEQNGIRQLLERKEGMFRMKMM
GKRVNYGGRSVISPDPYITTDQIGVPIFMARRLTFPESVAEVNAEHLRKLVMNGPKQHPG
ANMIEDEETGVRTNLESMSFDQRRGLAQLLTVGRKIVYRHLNTGDVLLVNRQPTLHKPSI
MAHIARILPKEQTIRMHYANCSTYNADFDGDEMNLHFPQSYLACSEAYKLMATHKQYIVP
TSGKPIRGLIQDSVVSGVFLTSKDTFLTKETYQQLVYVGLRELIEEDKIGKIFTLAPALL
KPVPRWTGKQVISTIIKNIVNQEMDYKINNITGLNLDSKAKLSPKEWGSIGQEEGDVVFR
DNELLLGTLDKNQFGASEFGLVHSFYEIYGSEKAGELLTSLARIFTVFLQMHGFTCGLED
LMITPEFNKQRRLIIENAHKEGIEAAAKFCGIKNYIAKEFNYSNRIVYQSGKNKIDQDIE
RFTNMAVPENPFKNKKIIQEDDPIRKRLEEKMNSADDVQALDAELDNVMRSKMSQATSQI
LKICIPDGLVKRFPRNNISAMVLTGAKGGLVNMTQISCLLGQQELEGKRVPKMQNGKTLP
CYLPYDPNPRSSGYVTDRFISGLRPQDFYFHCMAGREGLIDTAVKTSRSGYLQRCLIKQL
ESLVVNYDMTVRDNDGSIVQFLYGEDGIDVMNSKYLEKFDFLEKNFTSLITTYNGSEIMQ
RVDRNAVDDYKHKAKKVLKKMKKENPSITNHELKRYRGDPAISLYHPLKYFGSISEKMDS
KLKSYLENDSMQQLTAKMGNMAMKQKFEPIKGDTFKKMYFLKYMKSVVHPGENVGTIAGQ
SVGEPSTQMTLNTFHLAGHGAANMTLGIPRLKEILMTTPTNIKTPNMIVYFRRELSLIKT
EMEMYANRYKRIKLCDVTKELKVTQEIATDDSGNILRLYNITLQIESVRRIAKYLGLEFK
DLVKVFSDQFIPLLMAEILKQLKKASQDQGQDDVQTNPGTKSTLNASKITKKFKANGDVD
EEFDVDNEDEIVKQASQKSKSSVKGDMNVDEDEDENEDEDDMMDIDGVEKKAKDIKGYEQ
EDEEDRDFLRRSSNNRSESKQKEDEEKNMNYYCNILREKFSKYQGYIRKIGYEDDKSMTV
TLGFPLQFKKILMLTVAEQILAKVLVRSVSGIDNCILVTPDKANEEPYLLVQGLNFEAFY
NDQDIFDVNRIQSNDIWQIMKKYGVEAGCANLVKEVRQVFNMYGIEVNYRHLSLIGDFIT
NNGEYRAFNRIGMEESSSPFLKMSFETTMKYLVASCVQKDTDDLSTPASALVLGQVPKVG
TGIFDIIHDPDYALA