Identifiers and Description

Gene Model Identifier

Contig21740.0.g8

Standard Name

POLN1

Aliases

Contig21740_0_g8

Description

DNA polymerase family A

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000437809.997093137033517e-262DNA polymerase I family protei
n

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21740.0.g8(coding)
ATGGCATCAACTAAATTTAAAGACATCGAACAAGGAGGAACTATTACGAAAACCAGAGGA
AGGCCCAAAGGTAAATCTATTAAATTATCATCTAAAGCAAAGGAAACTATTAAAGAATAC
ACCACAGATAGCAGGACATTGGAAAATGAATAAAGAGGGACTCTTAAAGAAAAGCCAACA
AAAAAGAGAGAAAAGAAAATTAAAGATGGATCGCTAAGTAATGGGAGCTCAAGTGCTAGT
ATTTCATTAACTGATGAAGAAAAGCTTGATTAACTTAAAACCATAATGGAAAAATAAAAA
GATATTACAGAAATAGATGAAGCTAAAGTGATAAGACTAAAAGAGGGTGTAAATGAAGCT
TTGAGAGATCTGGAAATTCCAGGGACCACAATCATTAGATCAAGGGAAGAAGCAAGAAGA
GTCGTTTAAATTTTGAAAGCCTATCCAGATAGGATACATGCTTGGGATACTGAAACTATA
CATATTGATGCCAAGGAAGAATCTCCAGTAGGTCATGGTTAAATTATCTGTGCTACAGTA
TTTATAGGTCCTGATGTAGACTTTGGAAATGGGCCAAGACTGTTCATTGATAATTATGCG
GATGCTTTAAACACTATAATGGAATTCAAAGAGTATTTGGAGGATCCTAATTACCTAAAA
TGCTGGCACAATTATGGCTATGATCGACACATTTTCTTTAATCATGGAATAAATGTGCAA
GGATTTGGAGCAGACACTATGCATATGGCAAGACTTTATGATCCATCTAAAATGCCAAAT
TAGTACTCACTTTCTGCCTTATCAGAAATTCTTAAAGGCAAAATAACAGAACAAAAATAA
CTAATGATACAAGACTTAAGATAAAAATTGTTAGTAGATCCATAGAAAAATGAAACATAA
CTATCAACTTTAAAAGATGGAACTAAAGGCAAAGTTTTAACTTTTCCAGATGTTGAAGTA
ATACATACAAATAAAGTAGAGGAATGGGTTGGATATTCATGCTATGATGCCGAAATTACA
TTTTTCCTTAGAGAAACTTTGAGTAAATTACTAATGACTTAATAAACAGATGAGGAAGGT
ATGCAGGACATGCTTGGTCTTTATTCAAAATATTGGCGGGCTTTTGGAGAAGTGTTGACT
GATATGGAAAGAGAAGGTATAAAAATAGATGTAGAATACCTTAAAGAAATTTAGCTGATC
GCTGAAAAAGATAAAAGTTAGTATGAAGAGAAGTTTCTTGAATGGGTTTACAAGATATAA
GAAGATGCTAAAGAGTTCAATCCTGCAAGTGCACATCAAATATAATAACTACTATTCGCT
CCTTTCAATAAAAGAGGCAAAAAGCCAACATTTGATAACGATGGCGAAATTATGTATGAG
TATCCAAAGGAAAGATTGTTTAAAGTAGAAAATACGGCTGGGTTTATTAAAGAAGGTAAA
AAGCAAGCATTAAAATAGAGAGAAATGAAAATTACAGGTCTTGGAATTCCGGCATTAGAT
TATACTTAGAGTAGCTTGCCATCTGCTGACACTCCAGTAATTAAGAGGCTGGCTGGAAGA
CCAGATAAGGGAGAATTTGGTGAGGCTTATAATTTCTTCTTAAGATAAGATAAAGAAGAG
GAAGGTAAAGAGTGCTGTTGGGCTTTATGGAATTGGATATAATATAAAGGTATTGAAACA
CTCCTAAATACCTACATTTTACCTTTGTAAAAAGCTCCAGATCAACATGGTAGAATACAT
TGCAGTATGAATTTAAACACTGAAACAGGGCGTTTGAGTTGCAGAAAACCAAACTTATAA
AATTAACCAGCACTTGACAAAGACAAATATAAAATTCGAAGAGCTTTTGTAGCAGACTAA
GGAAATAAACTCGTTGTTGCTGATTATGGTCAGTTAGAGCTGAGAGTGCTTGCACATATG
GCTAATTGTAAAGGAATGATAGATGCTTTTAAACTTGGTGGTGATTTTCACTCTAGGACC
GCTCTCGGTATGTATCCAGAAATTAAAAAGGATTTGGAATCAGGTGAAATTTTACTTGAA
TGGGACAACTCAAAGGGTAAAGCCCCAAAACCCCTGCTCAAAGACAAGTATGCAAATGAG
AGAAAGAAAGCAAAGATTATGAATTTTTCAATTGCTTATGGAAAGACTGTCCATGGATTT
ATGAAAGATTGGAATTGCTCAAAAGAAGAAGCTCAAGCAACAGTTGAACTGTGGTACTCA
GACCGACCTGAAGTTAAAGAATGGTAGAAAATGATCTAATCTAAAGCAATCACAAGGGGA
TGGACACAGACACTACTAGGAAGATATAGAAATCTAACAAAGCATTTTATTATGAGTTCA
ACCAATGAGGGATACTCTTTTAAATCAAATATGATGAAGGAACATGGATTGAGAGCTGCT
ATAAACACCCCAATTTAAGGAGGAGCTGCAGATATTGTGATTGCAGCAATGGTGAAATTA
CACAAGGACTAAATGCTAAAAGACTTAGGCTACAAACTACTCCTATAAATTCATGATGAA
GTAATTTTAGAGGGACCAGAAAAATATGCTAAGGAAGCACTGGAAAGAGTTATATACATT
ATGGAAAATCCATTAGACAATAGGCTAAGAGTCAAATTGGAGGTTGATGCTAAAATTGCA
ACTACATGGTATGAAGGAAAGTGA


>Contig21740.0.g8(protein)
MASTKFKDIEQGGTITKTRGRPKGKSIKLSSKAKETIKEYTTDSRTLENEQRGTLKEKPT
KKREKKIKDGSLSNGSSSASISLTDEEKLDQLKTIMEKQKDITEIDEAKVIRLKEGVNEA
LRDLEIPGTTIIRSREEARRVVQILKAYPDRIHAWDTETIHIDAKEESPVGHGQIICATV
FIGPDVDFGNGPRLFIDNYADALNTIMEFKEYLEDPNYLKCWHNYGYDRHIFFNHGINVQ
GFGADTMHMARLYDPSKMPNQYSLSALSEILKGKITEQKQLMIQDLRQKLLVDPQKNETQ
LSTLKDGTKGKVLTFPDVEVIHTNKVEEWVGYSCYDAEITFFLRETLSKLLMTQQTDEEG
MQDMLGLYSKYWRAFGEVLTDMEREGIKIDVEYLKEIQLIAEKDKSQYEEKFLEWVYKIQ
EDAKEFNPASAHQIQQLLFAPFNKRGKKPTFDNDGEIMYEYPKERLFKVENTAGFIKEGK
KQALKQREMKITGLGIPALDYTQSSLPSADTPVIKRLAGRPDKGEFGEAYNFFLRQDKEE
EGKECCWALWNWIQYKGIETLLNTYILPLQKAPDQHGRIHCSMNLNTETGRLSCRKPNLQ
NQPALDKDKYKIRRAFVADQGNKLVVADYGQLELRVLAHMANCKGMIDAFKLGGDFHSRT
ALGMYPEIKKDLESGEILLEWDNSKGKAPKPLLKDKYANERKKAKIMNFSIAYGKTVHGF
MKDWNCSKEEAQATVELWYSDRPEVKEWQKMIQSKAITRGWTQTLLGRYRNLTKHFIMSS
TNEGYSFKSNMMKEHGLRAAINTPIQGGAADIVIAAMVKLHKDQMLKDLGYKLLLQIHDE
VILEGPEKYAKEALERVIYIMENPLDNRLRVKLEVDAKIATTWYEGK