Identifiers and Description

Gene Model Identifier

Contig13216.0.g100

Standard Name

POLE2

Aliases

Contig13216_0_g100

Description

DNA polymerase alpha/epsilon subunit B

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam04042 ) DNA polymerase alpha/epsilon subunit B

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000489803.00033207980219e-32hypothetical protein
SGDYPR175W2.000769134519826e-18DPB2 SGDID:S000006379, Chr XVI
from 888974-891043, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13216.0.g100(coding)
ATGTCAGCGAACTTGAGTTCAGAAAGAGATATTGCGAAGTTTTTCTCACTGTCGGGCGTG
ACTGTGAGGCCCGATGCCTGCCAAGCAATCATCCAAGTCCTCCATAAACTCACCTACTTC
GATCACAAGAGAGCGTACTTGGAGAAGTTCCTAAAGCACATTAAGGATAGACAAATTATT
GGCTTGAACACTGAGGGCCAGGGCTTAAACAACTCCAACGGGGCCATGCTGCTTGATAGG
GAGACTGCTTTGACTATTTTATAATAAATGCCTATTAGTGAGAGTGATAATTATCTAGCT
GAATCTAACAACAAGACCTCAAATCAATCGTATGGAAGTTTCAAGGACATGAAGAAAATG
TAAGCTCTTAAAAACTAAGACACAGAAATGAAAAACGAGACTGGAGATATTTCACAAATA
TAAGTGAAGCGCATAAACCCTTTAATGCAAGATAAAGTGTACAAGAGTCTTCTAGAGTCT
GTGGTGATTCTTGAAGATTTCACTTAGTTCCCTTAACTCATTGTGTAAAACAATCAGCTG
TATTATTCCTTAACACTCAAGAGGACACTTAGTGAAGTTAACATTTCAAGATAAGACTAT
TATAACTATAGATTGCAACTTGCTGAGGATAGAGTATTTTCTCACACAGATAAATATGTG
AGACCAAAGCTAGAAGATGATAAATCTAGAAGTGATTCAAGTCTCACCAAGGTTTGCAAT
ATCAGTTCAATTATGGGTTCAAATCAAGCCAAGTGGGTGTTAGGAATTCTCACAATGCAT
GAAGATAGCGAGTATTATCTTGAAGACCAGCATTAAACAGTGAAAGTTTCCTTCTCTGAG
TTAGAATTTGCAGACCCAGAAGTTTTTTTCACAGAAAATAGCATTCTAATGTGTTGTGGT
ATATATCATAATGAAACTTACTTCCTCACTCAAATTAGATAGCCACCTCTACACGCCTAG
AAAAGTCTACAGTTTAAGGTTAATGAAAGAGATTACTTCGGTGCATATTCAAAAAAGAAA
ATGATGTTAGCCAAATAACAAGTTGATCCTACTTTTGCTCTCTCTGAATTAACCATAAAC
AATACTTCAAAGACGAGACCCGATGCTCAAAAAAGAGAAAAACCAGATGACTGCATAGTA
ATTCTTTCATAGTTAGAACTTGATTCTGTCAACACTCAAAAGAATCTGCCACAATTATTA
GAAGGTTTGGAATCAATGAAAGCTGATATCATAGTACTAGTTGGTAATTTTATTTCCTAA
AAGCTTTCAGAGAAGTTATCATATGATCAATTTAAGACTTATTTCGAAAGCATAGGACAA
GTTGTGAGGGAAAACAATTTGACTTTCTTGAGAGACAGTACTTAATGGATCTTTATCCCT
TCTGTGGATGACCCAGGTCAACCCAAATTAATGCCCTGTTTGCAATTCTAAGAATATTTC
CTGACTGGTTTCAAAGGCAATGGCCCTCAGAGAATCAAAAATGTCATCTTAGGCACTAAT
CCTATGAGAATTAGCTACTATGGCAAAGAGATTGTAATCTCAAGATACAACTTCTTTAAA
AAGCTAAAACGTAATCAAATTCCTAAAATCTAGATTGCCCAAGAAAAAACTAGAACTTAG
AATAATCAAAGCACAAGCTACAACTCTGATGATTCTTTCAAGATTGCCAAAACCGTATTA
CATTAAGGTACTTTAATCCCAGTCCCAAGTATTGTTCAGCCTATTATGTGGTCATTTAGT
GATGCCTTGCAATTAGTACCTCATCCAGATTTCCTTATATTATGTGATGAAATTACTGAC
TATCATCACCAAATTGAAGTTCCAAAGTCAAGTAAAACATCTCAGGGCTATGAGATTCAG
TATTTTGAAGATGAAGAAGGTCAAAACGATAAATTTGTGCATGTTGTTAACCCAGGAAAT
TTCTCAATTAATAAAAGTTTTGTTACTATTTATCCACTCTGTAAAGAAAATTTTGTTCAA
TAATGCTAGTTATGA


>Contig13216.0.g100(protein)
MSANLSSERDIAKFFSLSGVTVRPDACQAIIQVLHKLTYFDHKRAYLEKFLKHIKDRQII
GLNTEGQGLNNSNGAMLLDRETALTILQQMPISESDNYLAESNNKTSNQSYGSFKDMKKM
QALKNQDTEMKNETGDISQIQVKRINPLMQDKVYKSLLESVVILEDFTQFPQLIVQNNQL
YYSLTLKRTLSEVNISRQDYYNYRLQLAEDRVFSHTDKYVRPKLEDDKSRSDSSLTKVCN
ISSIMGSNQAKWVLGILTMHEDSEYYLEDQHQTVKVSFSELEFADPEVFFTENSILMCCG
IYHNETYFLTQIRQPPLHAQKSLQFKVNERDYFGAYSKKKMMLAKQQVDPTFALSELTIN
NTSKTRPDAQKREKPDDCIVILSQLELDSVNTQKNLPQLLEGLESMKADIIVLVGNFISQ
KLSEKLSYDQFKTYFESIGQVVRENNLTFLRDSTQWIFIPSVDDPGQPKLMPCLQFQEYF
LTGFKGNGPQRIKNVILGTNPMRISYYGKEIVISRYNFFKKLKRNQIPKIQIAQEKTRTQ
NNQSTSYNSDDSFKIAKTVLHQGTLIPVPSIVQPIMWSFSDALQLVPHPDFLILCDEITD
YHHQIEVPKSSKTSQGYEIQYFEDEEGQNDKFVHVVNPGNFSINKSFVTIYPLCKENFVQ
QCQL