Identifiers and Description

Gene Model Identifier

Contig23127.0.g34

Standard Name

POLD4

Aliases

Contig23127_0_g34

Description

DNA polymerase delta, subunit 4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam04081 ) DNA polymerase delta, subunit 4

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig23127.0.g34(coding)
ATGAGTACCTTGAATTCATATTTCGATCAGACCAAGAGAACAAACGCATCTCAATAACAA
TCAGGCAAAACCACAAAATAAGCGAAAGGGTAAGTTAAACAATAAGTTATGGAAAATCCT
GAGGACAGCTACCTTTAAGAACAAATGCATCGCTAACTATTTGACTTCGATCAAGATCAG
ACTTACGGGCCATGTAAGGGCATCTCAAGAATGTAAAGATGGACAAAAGCCTATAATCTC
GGACTTTATCCACCTCAAAGCATTCCCGACTTGATTAAACAGACTGGAATTGACCAAAGT
TATCTAGAACAGTACCTAATTTGA


>Contig23127.0.g34(protein)
MSTLNSYFDQTKRTNASQQQSGKTTKQAKGQVKQQVMENPEDSYLQEQMHRQLFDFDQDQ
TYGPCKGISRMQRWTKAYNLGLYPPQSIPDLIKQTGIDQSYLEQYLI