Identifiers and Description

Gene Model Identifier

Contig14382.0.g94

Standard Name

POL5

Aliases

Contig14382_0_g94

Description

DNA polymerase phi

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam04931 ) DNA polymerase phi
  • ( pfam07450 ) Formate hydrogenlyase maturation protein HycH

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004719300.0000000006999585478469937hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14382.0.g94(coding)
ATGGACGATAAAGACTTTTTAGGCTACTTCAACTAGCTAGCCCCACCCTCAACTGTTGAT
CAAATCAAGGCAGCTTCTTCAAAGATTGTTTCCACACTTGTAGCTATTGGCTAAGTAGGA
GGGAGAAAGGCTTCCACTGATTCCTCGTCATAAACCAAAGAAGCAGAGAAGGCAGAGCAA
TCACTCAAGAAGAAATATTTAACAGGTGATCTCGGAGAGAAGGTCTCAGCAGACTTAAAC
TATACTCTTAAGAGATTAGTTAGAGGTCTTAACTCAGATAATCATGCTGTCAAGCAAGGC
TTCTTCTTAGCCTCAGTCATGGTTCTTAATAAATTCAAAAACCAGATTGATTTCGATAAG
TATCTCAAGCATATGTTCAATGAAACTAAAGTTGCAAGCGGCATGAAGTCAGCAGAGACA
AATAACAACTCAATTGGTCGTATGATGTGCATTTCAGCATGTGTTGAAGCTAAGGTCTTC
GGATAAGGAATTCAAGTGAATCACAAGATCTTAAAAGTCATTGTTGGCTGTTTAACTGAG
CTATACCAACAAAATGATTTCATTTAGGAATCTATTTCAGCAATTTTCACAAAGATTTTG
CATCAAATCAAAGAGTAAAAGCAAATTTACCTCTCCACAATTGAGATTATTATGGAGCAA
CTTGTTATCAAGAAAAGCGAGGAAGGAGCTTAGAAAGGTGGTGTTGACTTCAAGTCAACT
GTCTTATCCGATTCCAATAAGCTTGGCCTCTTTTTGAGATTAAAGGAAGCTTACCAAGCA
GGATAAGCTGATGGTATGTCAAAAGGGGAATACTCTGAAGTCTTCAATTACAAGATCTTA
GCTGATAAAAAAAATCTTAAGCAAGTTTGCTATTTGGTATAGAGACAAACTTATCTCTAT
CCAAGACTTCATTCTTCATTACCTCTCCTCCTTAATGAAATTTCATCAGAATCTAAAACA
GCTGACAAGGCAAAGCTTATGCAACAACTCATTAACTCAGTAATCGTTGAATTTTTATTC
AATGATGAAGTATTCGCTCAAATGAAGAGCATGACTAAGTTTAAGTTCCTACACATTGGC
CTCAGATTTACTTAACTTGTTCTTTAAAACATTCAATCATGGGACACTAAGCAATAAAAC
AGAGAACAGTTGCTTGAGAATCTTATAAAGCCAAACTTCATGAAGATTTTAGTGAAAAAT
GTCTCAAGCTAAAAGAATCAACTTCACGAAGCTGCTGTATCACTTAAGGACACAATAGTC
TAATTCATTTCAAGCTCAAACCTCTCAGGAGAGTATTCTCTCAAGCTGTTACAGCAATTG
TTTGGACCAAACAGTAACTTGAGATTCTCAACTAAGAGAAATTTAGACCTCCTTAAGGTT
TTAACTTCCAGATTTGAAGAAGCTTAAGTTTCATAATACTTTAAGTTCTTACTAGGCTTG
TTTAATAACTCACCAATAGAAGAGCACTACCCAAGTGGAATGAATGAGGAAGATGAAACC
AAGAAAGAAGAAGTTAAAGAAAATGATAGCAATGATGACGAAGACGAAAAGCCAAGCGAC
GAAGCTATGAGAAAAGATTTGATCAAAACTTTCGCTTTGAATTAAATGGCTAACTTCCCA
CAAATGTTCAGAACTCAACTCACTAGTGAGCACGTGACTTCCCTCATTGATGTCTTAGTT
AAGGTTACTTATTTCCATACATCAGGGGATAAACAGAGCCAAGATATTTAGCAGTTAGGA
TAGTTTAAGCTTTTTGGAGTTGCTTAAATGCTTCACAAGATCAAGCTTGGTGACTTAGAA
AAAGGAATGAAAAATCATAATGATCTCTGGATTTCAGAGATTAATGCAAGCATTCAAAAG
CAAGCAGCTTCAAATAAGATAAAATCCCCTCTTATCACCTATCATCAAGAGCAAGTGAAA
TTCATTAAGGATGAGATCTCAACAAAAAGAGCTCAACTCTAAAAGGTTTTAAAGAAGAAT
GATGAGCAAAGCTTCAAAGTCAAGACATAATTCAAAAAACTCATTGCATTTGAACTTCTT
TTCCACAACCTAGCCTTATTAATTATGATTCCAGGATCAGCAGGAGGAGTAGCTGAAGAG
ACACAGTAAGACATTGAGGAAATGAAGGTATGCTTCCAGAAACTTAAATTGACTGAAAAC
ATTCCAACTGGAAAAGACAGCAGCAACAAGAGAGCAAAGAAGGATGGCAAGCAGTCTGAA
GAGCAAGAAGAAGCCCTCCAAGTTTTGTTTGATTTCTTGATTTCATTACTTACTAAGCAG
CAAAGCTTCTTGAGAGAAATTGCTAACTTCGCTTTCAAGCAGTTCTGTAGCCAGATTTCC
ACAGCTTCATTGATGAATATGATGCAGATTATGCAGACTCCTAATGTAGAAGCAAACAAG
ATGCTCTTTGACGAGGATGAAGAAGCAGAAGGAGCTGAAGGTGATGAAGTTGAAGGAGCT
GAAGATGAAGAAATGGAGGAAGACGAAGAAGACGATGATGAAGATGATGAAGATGAATCA
GAATGA


>Contig14382.0.g94(protein)
MDDKDFLGYFNQLAPPSTVDQIKAASSKIVSTLVAIGQVGGRKASTDSSSQTKEAEKAEQ
SLKKKYLTGDLGEKVSADLNYTLKRLVRGLNSDNHAVKQGFFLASVMVLNKFKNQIDFDK
YLKHMFNETKVASGMKSAETNNNSIGRMMCISACVEAKVFGQGIQVNHKILKVIVGCLTE
LYQQNDFIQESISAIFTKILHQIKEQKQIYLSTIEIIMEQLVIKKSEEGAQKGGVDFKST
VLSDSNKLGLFLRLKEAYQAGQADGMSKGEYSEVFNYKILADKKNLKQVCYLVQRQTYLY
PRLHSSLPLLLNEISSESKTADKAKLMQQLINSVIVEFLFNDEVFAQMKSMTKFKFLHIG
LRFTQLVLQNIQSWDTKQQNREQLLENLIKPNFMKILVKNVSSQKNQLHEAAVSLKDTIV
QFISSSNLSGEYSLKLLQQLFGPNSNLRFSTKRNLDLLKVLTSRFEEAQVSQYFKFLLGL
FNNSPIEEHYPSGMNEEDETKKEEVKENDSNDDEDEKPSDEAMRKDLIKTFALNQMANFP
QMFRTQLTSEHVTSLIDVLVKVTYFHTSGDKQSQDIQQLGQFKLFGVAQMLHKIKLGDLE
KGMKNHNDLWISEINASIQKQAASNKIKSPLITYHQEQVKFIKDEISTKRAQLQKVLKKN
DEQSFKVKTQFKKLIAFELLFHNLALLIMIPGSAGGVAEETQQDIEEMKVCFQKLKLTEN
IPTGKDSSNKRAKKDGKQSEEQEEALQVLFDFLISLLTKQQSFLREIANFAFKQFCSQIS
TASLMNMMQIMQTPNVEANKMLFDEDEEAEGAEGDEVEGAEDEEMEEDEEDDDEDDEDES
E