Identifiers and Description

Gene Model Identifier

Contig16033.0.g63

Standard Name

POL4b

Aliases

Contig16033_0_g63

Description

Fingers domain of DNA polymerase lambda

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007325503.999413844471248e-84Helix-hairpin-helix motif fami
ly protein
SGDYCR014C0.00000000019994075865167896POL4 SGDID:S000000607, Chr III
from 140933-139185, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16033.0.g63(coding)
ATGACTGACAAAAAGAAAAGAATATTACCTGCAAGTTTAGATTCACAACAACCAGTAAAT
AAATTATTGAAAAAGATTTCATTAAACGATTCAAAAGAACACTCACTTAAAAATGAAACT
GCACTTCGATAATAAATATTAATAGATAAAAATCTATTCTTTAAAGATGTGAAGGCAGCT
TTTGTTATGATTGGTAAAGAAATGACTAAAAAAAGAGTGGAAATTTTCACTTATTTGATA
AAAGAGTTAAATTTACCATTTAATCACGAAAACATACAATCTGAGATTAATCAAAGAATT
TATGAAATACTAAGGCCAATTAAAATTGTCACTCCAGAGTGGCTTACTAGATGTTTAATG
GAAAAGAAACTCATTAGTAATATTGAACCATACGAAATTAAAATTGAGATTCCAAATAAA
GAGGAAGTACAATTAAGAAAAATTAATAGCGGCGTATCTGACCAGAAAAACTATGAGGAA
GAGAAATTAGATAGAGTCGTTAATCTTGAAGAAATTATAGATGACATTTATAGAATGAAA
TTCTAAAAAGATGGTAAAAATTCGTAAAAGCGAGTGTTTGATGAACTATCCAAAAGCAGT
AGTAATATTCTTCATAAAAATGAAACCAAATCTCATTTAAATGGTAATTAGTCACAAGAA
AACGAAGATGAAAATTTTGGTATTAATTTGCATGAAGAGTCATCTCACAGATCTTTAAGG
TCTAAGTTTTATAAGGATGGGGAGGAATGTTTCTCAGAAGATTCGTATTTGCACTCTTGG
AAACCAGAGTACATAGCAAATCGTGAAAATTATTGGGATAAAAAGAAGCATATGTTTGCA
TGCTCTCGTGGATCAACTCTCAAGGAAAATCAAATAATAGAGGATGGGCAAATTAAAGAA
CTATCTGATGTAAAATAAGAAAATCTTAGTTAAGATGCTAATTTGGCGTCTTAAGAAATG
ATTGACACTTAAACAACTAAGAAGAAGCCAATGAATGACGAAATAATAAAATAATTAGAG
AAATTGTACAAGTACTATGAGGCTCAAGATGACAAGGGAAGGATGCATGGATACAGAAGA
GGTTTGACATTTTTACGTTCTTACAAAGACCCAATATACTCAGTTGAATAATTAGAGAGC
GTCCCATACTTGGGCAATGGTATTCTAAAGAAAGTCTAAGAACTTATAGAAGAGGGGTCT
ATCAAACGGTTTGAATTTTTATCACATGATGAAAGCGTAGTTGTCACAGAATTACTAGAG
GGTGTTTGGGGAGTAGGTCCAAAACTTGCATAAAAGCTTTATAAACAAGGAATAAGATCG
ATTGAGGACTTAAGATAGAACCAACACCTGCTTACTGAAATGTAAAAAATAGGATTGAAA
TACTATGAAGACATAAAACAGCGTATTCCAAGACACGAAGTTACATAGATGCTAGAATTA
ATTAGATAAACTGCTTTTGGTTTAATACCTAACGGTGAGAAGCTTTTGAAAGTGGATGCT
TGTGGTAGTTACAGGAGAGGCAAATAAAGTTGTGGAGATATCGATATTCTAATTACAAAG
GTTGATGGCTCATCTATTCATGGATTTGTAAAGCTATTAGTCTTAGAACTTGAGAAGTAA
GGGTTTCTTAAAGAAAGATTAGGTGGATTGAGATTTTCGCACATTGGTAGTGAAGGATAT
ATGGGAATGTGTCAGCTGAGACCTGATTTACCATTCCGAAGAATAGATATTAAAGCCTAT
CCGCTGTCTTAATATGGCTTCGCATAGTTGTATTTCACAGGAAGTGGTAATTTCAATAGA
AGTATGAGGCTTTTTGCTTAGAAAAAGGGTTACAGCTTAAGTGACTACGGCCTCACGCCT
GTTATAAGAGTGAAAGGAGAAAAAGTTGCAGAATTTGAAAGTGTCCCCTGCGAAACAGAA
GAGGATGTATTTAAAGCTTTGAATTTGGATTATAAGCCACCCTATGAAAGGGATATTTGA


>Contig16033.0.g63(protein)
MTDKKKRILPASLDSQQPVNKLLKKISLNDSKEHSLKNETALRQQILIDKNLFFKDVKAA
FVMIGKEMTKKRVEIFTYLIKELNLPFNHENIQSEINQRIYEILRPIKIVTPEWLTRCLM
EKKLISNIEPYEIKIEIPNKEEVQLRKINSGVSDQKNYEEEKLDRVVNLEEIIDDIYRMK
FQKDGKNSQKRVFDELSKSSSNILHKNETKSHLNGNQSQENEDENFGINLHEESSHRSLR
SKFYKDGEECFSEDSYLHSWKPEYIANRENYWDKKKHMFACSRGSTLKENQIIEDGQIKE
LSDVKQENLSQDANLASQEMIDTQTTKKKPMNDEIIKQLEKLYKYYEAQDDKGRMHGYRR
GLTFLRSYKDPIYSVEQLESVPYLGNGILKKVQELIEEGSIKRFEFLSHDESVVVTELLE
GVWGVGPKLAQKLYKQGIRSIEDLRQNQHLLTEMQKIGLKYYEDIKQRIPRHEVTQMLEL
IRQTAFGLIPNGEKLLKVDACGSYRRGKQSCGDIDILITKVDGSSIHGFVKLLVLELEKQ
GFLKERLGGLRFSHIGSEGYMGMCQLRPDLPFRRIDIKAYPLSQYGFAQLYFTGSGNFNR
SMRLFAQKKGYSLSDYGLTPVIRVKGEKVAEFESVPCETEEDVFKALNLDYKPPYERDI