Identifiers and Description

Gene Model Identifier

Contig17557.0.g86

Standard Name

POL3a

Aliases

Contig17557_0_g86

Description

DNA polymerase family B

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00136 ) DNA polymerase family B
  • ( pfam03104 ) DNA polymerase family B, exonuclease domain
  • ( pfam14260 ) C4-type zinc-finger of DNA polymerase delta
  • ( pfam13482 ) RNase H superfamily
  • ( pfam05608 ) Protein of unknown function (DUF778)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003003809.997093137033517e-262DNA polymerase family B contai
ning protein
SGDYDL102W9.997093137033517e-262POL3 SGDID:S000002260, Chr IV
from 276872-280165, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17557.0.g86(coding)
ATGGAATCGAGATATAGCGGTGCAGCAAATAACAACTTCTCTTCTAGTTAGAACGAATTA
GAGGAAGCTCCAGAATTTCTTAAGGGGCCTGATCTTTCAAATAAGACAAACATTAGAAGA
CCCCCTTGTCCTACTATTAACTCAGATGAAATGAGCATTGAATTTATGCAAATAGATGTT
GACTACTACACTGACTTTACACCAGAATACGTAAAGAGACCAGATCAAAATGAGACTTGC
GTGATAAGAATGTTTGGTATAACTTAAGCTGGTAATTCGGTGGTAGCTCATGTGCACAAT
TTCACTCCTTATTTCTATGTTGAAGTTGATACTCGCAAACTTGCTTAACCTTTAACTCCT
CAAGACTTAATGAGTATCAAGTCTGACCTTAACAACTGGAACAAAGGCCAAGAGTGCATT
AGATCCATCGAATTAACACAAAAATCTTCAGTTATGCATTATCAAGAAAAGAAGAACACT
TTCTTAAAGATCTATACTACTCTGCCAAAATATGTCAATTAACTCAGATCTGTATTTGAA
AACGGAAGCTACAGCTATAAATCGCAACATTGTTTCTAGCATGTCACTTTTGAGTCTAAT
TTACCTTATGCTTTGAGATTTATGATTGATAACGAAGTGGTTGGTATGTCTTGGATTAAA
GTGAACGCTGGCAATTATGCTGTGAGACCAAGAAATTTAAGAAAAAGTAATGCCTAAATT
GAAATTGATGTCGAAAATTTCAATCATGTTGAGTGCTTACCATGTGAAGGAGACTACTCT
AATATTGCTCCTCTAAGAATCTTGTCTTTTGATATTGAATGCTCAGCTGATAAAGGCAGG
TTTCCATAACCTCAACTTGATCCCATCATTCAAATTGCTAACATTGTGAAAATCCATGGA
GAAAAAGAACCATTCGTCAGAAATGTTTTTACTTTAAAAGAATGCGCTCCAATTGTAGGA
TCTCAAGTTAGTTCTTATCAAAGAGAAGAGGAGATGTTAAGAGCATGGAAAGATTTTCTT
GTTGAAGTTGACCCCGATATCATAACTGGGTATAATATTGTAAACTTTGACTTCCCCTAC
ATAATCAACAGAGCAATTGCCCTTCACATGAATAAATTTGCACATTTTGGTCGTATTCTT
GGTGTTGAATCAAGAATTAAAGCTAACACCTTTTCTTCCAAGGCACTAGGTACAAGAGAG
ACGAAAGATATCAACATCGATGGTAGAGTGTAATTTGATATGCTCTAAGTAATTTTAAGA
GAACATAAACTCCGTAGTTATACTTTGAACTCAGTCAGTGCACAGTTCTTAGGTGAGCAA
AAAGAAGATGTTCCACATACTATTATCAGTGATTTGCAAAATGGAACTGAATACACAAGG
CGCAGATTGGCTGTGTATTGCCTGAAAGATGCCTATCTACCTCTAAGATTGATGGAAAAA
CTTATGTGTTTATTCAATCTTACTGAGATGTCTAGAGTTACAGGTGTACCGATTAGTTTC
TTATTCACAAGAGGTCAGTAGATTAAGGTCGCATCACAGCTATACAGAAAGGCTAAAGAA
TACGATTTGATTATTCCTGTAGACAAAACAGCGGCAATGGAAGGAAAATATGAGGGAGCA
GTGGTTATAGAACCCACTAGAGGCTTTTATACGGATCCAGTAGCAACATTGGATTTTGCT
TCTTTGTATCCATCAATTATGATGGCTCATAACTTGTGCTACTCTTCTTTAATCCCAGCT
CATGAAATTGGGAAGCATCCATTGGAAAACTATATTAAAACACCAAATGGGGATTATTTT
ATGAAGTAATCTGTCAAGAAAGGACTATTACCTATGATTCTAGAAGAACTTTTAGCTGCT
CGTAAGAGAGCAAGACAAGAATTAGCCAAGACTACTGATCCTTTCCAAAAGGCCGTGCTC
GATGGTAGATAACTAGCCCTTAAAATCTCAGCTAATTCTGTGTATGGATTTACAGGAGCT
TAAGTTGGGCAACTCCCCTGCCTTGCAATTTCATCTAGCGTCACCTCTTATGGGAGAGAA
ATGATTGAAGCCACTCGAGCCTATGTTCTATAAAAGTATAACAAAGAGAATGGCTATGAA
TTCGACAGTCAGGTTATCTATGGTGATACTGATTCAGTTATGGTAAAGTTTGGAGTTAAG
AGTATTCAAGAGGCTATGAAACTAGGTCAAGAAGCAGCTAATTATGTAACTCAGTTTTTC
TAGTAACCAATCAAGCTGGAGTTTGAAAAGGTCTACTGTCCTTATCTTCTCATGAATAAA
AAGAGGTATGCAGGATTACTTTGGACTAAACCTGAAAAATTCGATAAAATGGATTGTAAA
GGTATTGAAACTGTAAGAAGAGATAACTGCGGTATTGTCAAGGAAGCTGTTTAAAGTGCT
CTTAATATGCTCTTAATCGAGCAAGATGCTGAAAAGGCGTTAGACTACTGCAAAGGTATA
GTCAGTGATTTGTTGCAAAACAGAATTGATTTATCTTTATTGGTCATTACCAAAGGACTT
GGTAAAAAGACTGCCAAACCAGAGACAGATGCCAATAAACCCCAGGGTTCAGCTAATGGC
TAATATCATGGTAAGCAAGCTCATGTAGAATTAGCAGAGCGCATGCGCAAGCGTGACGAG
GCATCTGCTCCATCTTAAGGTGATAGAGTAGCTTATGTTATGGTTAAAGGAGCCAAGGGA
TCAAAAGGATACGAAAAATCAGAGGATCCACTCTATGTACTTCAACACAACTTGCCCATA
GATTTCTAATTCTATTTGGATCACTAGATTAAACTCCCACTGCTCAGATTGTTTGAACCT
ATATACAAGGATGCTGAGAAGATGCTGTTCTCTGGAGAACATACTAGAAGCATATTCGTG
CCTAAGGTATCTGCTTCATAAGGACTTGGTAAATTTACAGTTGCATCGAGGCAATGCTTG
GGATGCAAGACAGTTTTGCCTAAATCAGAATAAGACTGTGTTTGCAACAACTGCAAACCA
AAGAAAAAGTAAATTTACATAGAAAGAAAGTAAGAATCGAATCTCTATGAGAAAGCTTAT
GCCGACCTTTGGGTTCAGTGCTAGAGATGCCAAGGATCACTTCATGAGGATATTTTGTGC
TCAAGCAGAGACTGCCCTATTTTCTATAGAAGACTTAAAGCAAAGAAAAACTTGGAGGAG
AATCAAGAAATACTAACTGGATTCCTAGACTGGTGA


>Contig17557.0.g86(protein)
MESRYSGAANNNFSSSQNELEEAPEFLKGPDLSNKTNIRRPPCPTINSDEMSIEFMQIDV
DYYTDFTPEYVKRPDQNETCVIRMFGITQAGNSVVAHVHNFTPYFYVEVDTRKLAQPLTP
QDLMSIKSDLNNWNKGQECIRSIELTQKSSVMHYQEKKNTFLKIYTTLPKYVNQLRSVFE
NGSYSYKSQHCFQHVTFESNLPYALRFMIDNEVVGMSWIKVNAGNYAVRPRNLRKSNAQI
EIDVENFNHVECLPCEGDYSNIAPLRILSFDIECSADKGRFPQPQLDPIIQIANIVKIHG
EKEPFVRNVFTLKECAPIVGSQVSSYQREEEMLRAWKDFLVEVDPDIITGYNIVNFDFPY
IINRAIALHMNKFAHFGRILGVESRIKANTFSSKALGTRETKDINIDGRVQFDMLQVILR
EHKLRSYTLNSVSAQFLGEQKEDVPHTIISDLQNGTEYTRRRLAVYCLKDAYLPLRLMEK
LMCLFNLTEMSRVTGVPISFLFTRGQQIKVASQLYRKAKEYDLIIPVDKTAAMEGKYEGA
VVIEPTRGFYTDPVATLDFASLYPSIMMAHNLCYSSLIPAHEIGKHPLENYIKTPNGDYF
MKQSVKKGLLPMILEELLAARKRARQELAKTTDPFQKAVLDGRQLALKISANSVYGFTGA
QVGQLPCLAISSSVTSYGREMIEATRAYVLQKYNKENGYEFDSQVIYGDTDSVMVKFGVK
SIQEAMKLGQEAANYVTQFFQQPIKLEFEKVYCPYLLMNKKRYAGLLWTKPEKFDKMDCK
GIETVRRDNCGIVKEAVQSALNMLLIEQDAEKALDYCKGIVSDLLQNRIDLSLLVITKGL
GKKTAKPETDANKPQGSANGQYHGKQAHVELAERMRKRDEASAPSQGDRVAYVMVKGAKG
SKGYEKSEDPLYVLQHNLPIDFQFYLDHQIKLPLLRLFEPIYKDAEKMLFSGEHTRSIFV
PKVSASQGLGKFTVASRQCLGCKTVLPKSEQDCVCNNCKPKKKQIYIERKQESNLYEKAY
ADLWVQCQRCQGSLHEDILCSSRDCPIFYRRLKAKKNLEENQEILTGFLDW