Identifiers and Description

Gene Model Identifier

Contig12716.0.g74

Standard Name

POL31a

Aliases

Contig12716_0_g74

Description

DNA polymerase alpha/epsilon subunit B

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam04042 ) DNA polymerase alpha/epsilon subunit B

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006911705.000040196085687e-64hypothetical protein
SGDYJR006W6.001055639413166e-58POL31 SGDID:S000003766, Chr X
from 449202-450665, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12716.0.g74(coding)
ATGAGCACTGGTGAGTCTCTGCACAAGCGTTCAAACGAGACCTACAAACTCCATGATGAA
TAGTACATTATCAAACACAATTCAAAGGATATTGTACAGTATGCAACATTTTATTGGCTG
AGATTACAGAGTCTCAAGCCTCATGTCAGGGAAAGTGCAGAATTGAAGTGGGAGAAAGAT
TAGCATTTGACTTATGTCACAAACATTTTGGATATAAGACCTGGTCAACTTACAGTCATA
ATAGGTACTATTTTTAAAGAAATGCCTCTCAAGCCTTCAATCTTGAAAAATGTATTGGGT
GTTCTTGGAACTCAGAAATTCAAGCATGGTTTGTATGTCGGGGAAGAGGATTATGCAGTT
TTAGAGGACAGCTCAGGCAGAATAAGATTAAAGAAGGGCTTAAAGTTCAATCCAGATTTC
TTCGTATCTGGTTCAATTCTAGGCTTAAAAGGAGTTGTAGATACAAACGGCTTCTTTGAA
GTTCATGATCATACTTATGCAGGTATTCCTTTTAGTGAACCTCTCCCTAAAAGTGTTAAT
ATAAGAAACCAAAGAGATTTGTACTCCCCAGAGGCCCTAAGTGATCCAAAGAGAGAATTC
GTGGCACTAGTTAGTGGTTTGGAATTTGGCAAGACTACAGATGTATTTTCATCTGAAATG
CTAATTAGGTTCTTTAAAGGTGAACTTGGTGGTCCCAAAAATGCTAAATTGGCAAGTTAA
ATTTCAAGAGTCGTGATTTGCGGAAATTCAATTGTATAGCCAGAAGATACCGATTAAGTT
CTCAGAGGTTCCTACAGAGTGTAAAACTTAAATCAAAGAGTATATAAGACTATCTCAGAT
GTTTTAGACACTTTCGAACTTTTCTTACATAATCTATCACAACTAGTTGATGTGGATATC
ATGCCTGGTTAAGACGACTTCAGTTCCTCATTCTTGCCCCAATAACCCCTTAACTCATGC
TTGTTCCCTCAACTTCAAGATAAGCAATCAATTAACTTGGTAACTAATCCTCATAAATTC
GAAATGAATGGCTTAAAGTTCTTAGGATGCTCTGGCTAGAATTTGAATGATATTTATTCT
TACACAAAGGGCAATCTATTAGCCAATTCAACTGAGTAAAACTATGATGCTTTGAGTGGT
CTACAGCTGACTCTAGAAATGAGACATGTTTGCCCTACAGCCCCAGACACCCTTCGTGCC
TATCCTCAACTTGAAGAAGATCCCTTTATCATTGATAAAGCTCCACATGTATATTTCGCA
GGAAATCAAGCAGCTTATCAAGAGGATATATTATTAGCAGACAACAATCAAAAGCACTCA
AATTCTTCATTTATTCAGGGAGTCAAACTAATCAGTGTCCCTACTTTCAGTTAAACCAAG
AGTATCGTATTACTAGATTTGAGTACCTTACAAAGCTATGAAGTGAAGTTTGACTTGAGT
GAGGGAGTTATGCCAAGTAATTAAATGATCGAAAGCCCAGCTAAGAAGGCCTCAGTAGAT
ATTAATATGGAATGA


>Contig12716.0.g74(protein)
MSTGESLHKRSNETYKLHDEQYIIKHNSKDIVQYATFYWLRLQSLKPHVRESAELKWEKD
QHLTYVTNILDIRPGQLTVIIGTIFKEMPLKPSILKNVLGVLGTQKFKHGLYVGEEDYAV
LEDSSGRIRLKKGLKFNPDFFVSGSILGLKGVVDTNGFFEVHDHTYAGIPFSEPLPKSVN
IRNQRDLYSPEALSDPKREFVALVSGLEFGKTTDVFSSEMLIRFFKGELGGPKNAKLASQ
ISRVVICGNSIVQPEDTDQVLRGSYRVQNLNQRVYKTISDVLDTFELFLHNLSQLVDVDI
MPGQDDFSSSFLPQQPLNSCLFPQLQDKQSINLVTNPHKFEMNGLKFLGCSGQNLNDIYS
YTKGNLLANSTEQNYDALSGLQLTLEMRHVCPTAPDTLRAYPQLEEDPFIIDKAPHVYFA
GNQAAYQEDILLADNNQKHSNSSFIQGVKLISVPTFSQTKSIVLLDLSTLQSYEVKFDLS
EGVMPSNQMIESPAKKASVDINME