Identifiers and Description

Gene Model Identifier

Contig1027.0.g88

Standard Name

POL2

Aliases

Contig1027_0_g88

Description

Domain of unknown function (DUF1744)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam08490 ) Domain of unknown function (DUF1744)
  • ( pfam03104 ) DNA polymerase family B, exonuclease domain
  • ( pfam00136 ) DNA polymerase family B

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001125209.997093137033517e-262DNA polymerase family B, exonu
clease domain c...
SGDYNL262W9.997093137033517e-262POL2 SGDID:S000005206, Chr XIV
from 148212-154880, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1027.0.g88(coding)
ATGCGAAGAGGAGGATTTTAAAAGCCCGCAATTTAAGCGAAAAAGGCCAAATTTGATTCA
GATAACTTTGAGTCAAGTATTGGCATTAACTTTGAGGAATTACCTGCTAAGAAGATTGGA
TACTTAGCAAATTTCAAGACTATCTCGTTTTAAGACTAAAATGGCGGGGATCTCTCAGCC
ATTCTAATGTACTTTATCGAACCTCATGGCTAGTGGTTCAAAGCTATGCTTCAATATGAA
CCTTACTTCTATATCTTATGTGCAAATGAAGCTGTAAAAGAGATAGTGTTCTATCTTAAC
AAGACCTTTGAAAATACTATATCAAAGATAGACTATGTAGACAAGGAAGATCTAAATTTA
ATCAATCACTTATCAGGCAAGACTCAAAAGTATCTCAAGCTATCCTTCAAGAATATCTAA
GACTTGGTTACCGTGAGAAATGAACTTTAAATCATTGTGCAACGCAACCTTAAGTACAAG
GAGACTATGGAAGTGTATGAGGGTTTCTACGATTCAAGCAACTTAGCTAACTAGCAAATG
GATAGTTCCTAATATCTTAGTAAAATTTATGAGTTAAGAGAGTATGATGTAAACTATCAT
ATTCGTGTAGCCATTGACCTTGAAATAAGAACCGCCTTCTGGTATGAAGTTGATATGGAT
GGTCCACTAGTGACTAATATCAAACATTTGAAAGATAAACTCGACAAAGCAGACTTGAGA
ATTCTAGCTTTTGATATTGAAACAACTAAAGCCGCACTTAAATTCCCAGACAGTAGGTTT
GATCAAATTATGATGATATCATATGTTATTGATGGCAAAGGATTCTTGATTACCAACAGA
TAAATTGTTGGAGGGGATGTAGAAGATTTTGAGTATAGCCCTAAGCCAGAATATGATATC
GGTATCTTTACTGTGTTCAATGAAGCCGATGAGAAGGGACTATTAGATAAATTCTTCAGC
CACATCAGAGAAACTAGACCATTCATTTTTACTACTTTCAATGGAGACTTCTTCGATTGG
GTTTTCATACAAGACAGATGTAAATTCTACGATATGACTCTGGAAGATCAAATAGGAGTT
TACTGTAACTCGCAATCAGAGTACTCTGGAAGATTCGCAGTGCACATGGATTGCTTCTAC
TGGGTGCAGCGTGATGCCTATCTCCCTTAGGGATCTCACGGTCTTAAAGCAGTTACTAAA
GCTAAACTTGGCTACGATCCAGTTGAGTTAGATCCTGAGCTTATGGTCCCATATGCTAAG
GAACGCCCCCAAGAATTAGCTGAATATTCAGTTTCTGATGCAGTAGCTACCTATTTCCTC
TATTAAAAAATGATACACGACTTCATTTTCGCGCTCTGCACTATTATTCCAACCAACCCA
GATGAAGTACTGCGTAAAGGTTCTGGAACTCTCTGCGAAGACCTGCTTATGGCTCAAGCC
TTCAGATGCAACATCATCTTCCCAAACAAGCAATCAGATAAATTTGAGAAGTTTTATCAT
GGTCATTTGATAGACTCCGACACCTACATCGGAGGTCATGTGGAATGTCTGAGGACTGGT
GTTTATAGGAGTGATATTCCTGTTAAATTCAGACTTGAAAAGGCTGGTTACTAGCATCTC
ATTGATCAAACTGAAGCTATTATGGACTTTGCCTTGAAAGTAGAACTCAATGTTGATAAA
AATCTAGTCACTAACTATGATGAATTGAGAGATGATATAATAGCAAAACTTCAATCAATT
CAGCAGAAATGCCCATCTTATGAAGTCGAACCACTTATCTATCATGTAGACGTTGCTGCT
ATGTACCCCAACATCATCTTGTCAAATAGACTCCAGCCAGTTGCAATCGTGAATGAGCAA
ATCTGTGCAGGTTGCATATTCAACAAAGATGAAAACAATTGCAAGAGAAACTTGAATTGG
TAATGGAAGGGAGAGTACTTCCCACTCACAAGAAAAGAATACGAGGGTGTGAAGACTCAG
CTGGAATATGAGCTTGAGAAAGACAATGAAAATAAACCTGCTTAATATTAGAGGGAGATT
AACCTCAATACTTAAAATGAGTAGCTACTGTTGAAGCAGAGAGTTAAGAAGTATTGCTCT
AATGTATATAAACACGTGCATTAAACTAAGATTGACCTTAAGAGCGATACTGTGTGTATG
AGAGAGAACAGTTTCTATGTTGATACTGTCAGGGATTTCAGAGATAGAAGATATGACTAC
AAGCATCTCGTAAAAGTATGGGCAGGAAAATATAACGAAGCAGTCCAAGAAAACAACGCC
CTCAAAATCGAAGAAGCCAAGAACTTAATGAATCTCTACGAATCACTTCAGTTGGCACAT
AAGATCATTTTGAATTCTTTCTATGGATATGTCATGCGTAGAGGTGCTAGATGGTACTCT
ATGGAGATGGCAGCTATGGTCACTCACACTGGTGGTTCAATCATTATGGATTCAAGATCT
CTCTATGATCAAATCGGTATGCCACTTGAACTGGATACCGACGGTATATGGACTTTGTTA
CCAAAGGGTTTCCCTGAATAGTTCTCTTTCTAGCTATCAAATGGAAAGAAAGCTAATTTT
TCGTTTATTTGTACGATGAGTAACGTACTGATCTACGATAAGTACGGGAACAAACAATAC
TAAACTCTTGTCGATAAGAAAACACTAGAGTACGAGACTCGCACAGAAATGTCTGTGTTC
TTTGAAATCGATGGCCCATATAGAGCCATGGTTATCCCTGCTTCTAAAGAAGAAAACAAA
ATGCTTAAGAAGAGATATGCTGTGTTCAATCACGCAGGTAAAATGACTGAAGTAAAAGGT
TTTGAGTTGAAGCGTCGTGGTGAACTTAAACTCATCAAAATTTTCTAAGAAGAGGTATTT
TCCAAATTCCTAGAAGGCAAAACTCTTCAAGAGTGCTATGATGCATGTGGTGAAGTGGCA
GAGAGATGGTACGATATCTTAGACACTGAGGGTGAATACGTGGATGACTCTGAGTTGATT
GAGTACATCGGAGAAAGCAGATTTTTAAGCAAAGCTCTCAGTGAATACGACGGCAAGAAA
GCTTCAATGGTTACTTGTGCTCATAGATTGAGTGAATTCCTTGGACCAGAGATCGTTAAG
GGTAAAGGTATCAATGTTAAATTCATCATTTCTCGTAAGCCAGTAGATGCTAAAATTGCA
CAGAGAGCTATCCCCACTGCGATTTTTGAAGCTGACCCAAATGTCATGAAGAAATTCCTC
AGAAAATGGATGAAAGATGCTGGTCTCCAAGACTTTGACATGAGAAGCATCATTGATTGG
TAATATTACAAAGATAGAGTGTCAAGTACTATTCAAAAGATCATCACTATTCCAGCTGCT
TTGTAAAAATGTTTGAATCCAGTCCCAAGAATTTAATACCCAGATTGGTTGCACAAGAGA
ATCAAGGTCTAAGACGAAAAATTCAAACAAAAAGATATGAAGTATTTCTTCAAAAATTAA
GTGAAGCAACCTGCTATTCGGGATATCGAAGATTCAGCTCAAAGCTCTATTGCAAAACCC
ATTTAAAAACTGTCCCTAAATTCATCTACAAATCAAGTAAATGCTAAAAAACCAGAGATA
TCAGCCCCACAAGATAAATATGGTAAAATTGAGGACTGCCCACCTCCAGAAGATAATTTC
AAAGATTGGCTGAAATATCAAAAGAGTAATTGGAGAAAAATTAGAAAAGATATCAAAGAA
GAGAAATAAGTCATCAAACAAACAACTGTTTAGAAAAGCTAAGGACTAAACTCATTTATT
AGAAATATGGACGAGGTAGTTTTAAAGTCGACTTGGCACATTTTACAAATCTCTGAAACT
TTCGAGCCAGGTGTAATGAAAGTCTGGGCCATGACAGAAAGTGGGCAAATGTTTGCTGTG
AAGCTTAAAATTCCAAGAACCATTTACATCAATTCAAAGACCGTATGTGAGGATGCTGAC
TTCAAGAAAGTATAAAAGATATTGCCAAGAGAGAGAAAAGCTTATCACTTATATGAATGG
GAGAGCTCTGAAGACACTTTCTTGGAAAAGTTCCACAATTTAACTTATCATCACTTAATG
AACCCCACAGTTGAAGGAGTATATGAAACTAAGATGCCTCTAGTCTTCAAGGCAATTACT
GAACTGGGTTGCTTAGTAAAACCTAGATTTAATGCCATCCCTAAAAATGAGCAAGCTCTA
GGAAGAACTTATTCCCTTAAGGAATTTGAGCAGAAACAAATTGGTGCTGATAGTTAGTAC
ATGCCATCTACTGCTTTTGATAGGATCTATCTTCTTTAATCTTAAAGTTAAAACAACAGA
CACTTCTGGGGTCTCTTTATTGAATAGACAAAAGAAATCCAGTTCTTCGTTGTTAATCCA
GTAGCTAATGCTAAAAATCCAGCACTTCAAGGTCAGCTTAACTACAAATCACTTTTCTCA
AACACTTTGCAAGAAGCAGGATTTTCAACAGAATATATTAACTGGGAGATTAGCAACAAT
CAAAACACTTATAATGAATTAAACTTATGCTTGAAGGCTATCGACTAAAAACTTATTGAT
TACAAGTCTAAGGTTAAATCTGCGACTGTAGTGGTTTTACAAAGTGAGCTTACACCAGAG
AAGTTAATGTTTATGGGACTTCCCACACTTGCCAATGAATTTCCTTGCATGAAATGTCAA
TAGGTGGAAACTGATCAAGAATATCCAGCTTTGGATTGGATTAGATTTGCTTGCAAGAAT
ATGTCTATTAGATTTACTGAAATCAACGATTGGGTGAGAGATAAAATCAACTTTGCAAGA
TATTCATTTGTTCCAGTTTGTAACCTTGATGGAGACTCATCACTTTTCATTATTGATACA
CTCTATGCTAGAAATCTTTCTTAAAATAGACATATTCTCTGGTATTCTGACACTTCTAAG
CCAGATTTGGGAGGTCATGAAGATAAGGATTTTAGAATCTATTTCTAGGATGAAATTGAA
AATCCTGAAATAATTTAGAAAGGTTTCTATCGCAACTACACAGTTGAGATTGATATTACA
GAATTTGCTTTGAACACTATTCTTTAATCAGAGTATTTGAAAGATTTCGAAGAGGCTTCC
ATGTTAGCAACTCAATACAGGTAAGAAGATAAGAATGGAAACAGAGGAGAGGGTAATTTC
GCTAAAGTTGCCAAGCAGGACTTTGATAACGACCTGGATGAGTATGTCACATGTGCCGGC
ATCTTCAAGAGATTGAGAGACCTCGTGAATTGTTGGATAAAAGACATCATAGAAGATGAT
TAGTATGCGGACAGACTCACCCATTCTTTGTATAGATGGATTACCTCACCTACTGGTGCT
AAACTTTATGACCCTCTACTGCACAGATTAGTGCATTAACTGATGAAGAAGACCTTCTAT
TAAATGATTTATAGACTCAAGAAACTAGGTTGCTAAGTTATCTATGCTAATTTCCATAAA
TTAATCATACATACTCAAAGAGATACATTTGAAGAAGCTGAGAATTTCATCAATTTTGTT
ACTCATACTATCAAGTAAGATCCCATGTTCTCTTTCATCACAATGACTCCTAATGAGTAC
TATAAAATCCTACTATTCAAAGACTACTACAATTTTGGAGGTATCAAGGAATCAAACCCC
AGTAAGGTTTCAAACAAGTGGGACATCTGCTTGCATCTACCAGAAGCCATACAAAAGAAG
TTCCTGATTACAATTGGTGAATTTATTTTGAAAGTCTACAAGCACAACAAGAAGATGCTG
GAATCTGGACAATACGACAGAGCTCATATGGCAGCAGGAAGCAACCAGGATAATGGCCTG
AAAGAAATGATGAATGAAGATAGCAAGAAGATTGAATCGTACATGGACACAGTGGACGAC
ATCAAGAAAGAGAGAGATCACGACTACATAGTGCACGTGATCTCAGAGTACTTCAGTCAA
AAACTGTTCCCATTAGTTGGGGAGTTGCTTGCCAAGAAGGAAGACATGAATAAGGACGAT
TAGTATGAAGACGACGATGATTTGGACCTCGCTGACCATGAGGAGGGTTCTTAAGATTTC
GATGACTATGACTAAGATGAAAATGATTAGAACTTCTTGAATTAGGGCTATGCTCAGCAA
GATAACAGATATGTCAAACAGAGAAAACAGAGAGAGCGGGAGAGAAAGCAGAAGGAGCTT
AAGAAATGGGAGTTCCCACAGAGAATCGGATCATATAATGACTATAAGAACGCTGCTTTG
GAGTTCTCAAAGTAAGTATGCAAGAATGTATTCGGCTTGGATGAGGCTTTCTAAACTTAA
GTAACTACACTCAAGAGAAATCTTTTGAGTATCATAAGAGAGAAAGAGTTCTCAACCACC
GTAGTAAGCGCCACAGAACCAAGTTTGATCCTTGTCGTCCCTGATGTAATTTGCACATTC
TGTCAGACTAGTAAAGACCTGGATATATGCAGAGACCCCTCCCTGAACAAAGATCTGCAT
CAAAACAATTTGACCACGGAGTAGATTTCAGCAGAAAATTCACAATGGTTCTGTCAGCAA
TGTGATTCAGCTTTGAACAAGGGGCTTATAGAGAGAAGACTAGTAGAACTTTTAAATCGT
AGAGCAGTTGGCTACCAAATTCAAGATCTAAAGTGCATTAAATGCTTGATGGTCAAAAAT
ACTATCGTCAGCAGATATTGCCAGTGTACTGGACAGTTCAAAGCTACGGTTGGTTATGAG
AAGCCAGAAAAACTTAAGAATTCAAACTTGCTCAATAACATCACTGATATCAAGTTGTTC
GTGCAGTTGATGAGAAACTTCGGTACTTATCATAATATGCCCATTTTGAAGGATACTGCT
CAGCAGCTAATGATCTTATACAATTGA


>Contig1027.0.g88(protein)
MRRGGFQKPAIQAKKAKFDSDNFESSIGINFEELPAKKIGYLANFKTISFQDQNGGDLSA
ILMYFIEPHGQWFKAMLQYEPYFYILCANEAVKEIVFYLNKTFENTISKIDYVDKEDLNL
INHLSGKTQKYLKLSFKNIQDLVTVRNELQIIVQRNLKYKETMEVYEGFYDSSNLANQQM
DSSQYLSKIYELREYDVNYHIRVAIDLEIRTAFWYEVDMDGPLVTNIKHLKDKLDKADLR
ILAFDIETTKAALKFPDSRFDQIMMISYVIDGKGFLITNRQIVGGDVEDFEYSPKPEYDI
GIFTVFNEADEKGLLDKFFSHIRETRPFIFTTFNGDFFDWVFIQDRCKFYDMTLEDQIGV
YCNSQSEYSGRFAVHMDCFYWVQRDAYLPQGSHGLKAVTKAKLGYDPVELDPELMVPYAK
ERPQELAEYSVSDAVATYFLYQKMIHDFIFALCTIIPTNPDEVLRKGSGTLCEDLLMAQA
FRCNIIFPNKQSDKFEKFYHGHLIDSDTYIGGHVECLRTGVYRSDIPVKFRLEKAGYQHL
IDQTEAIMDFALKVELNVDKNLVTNYDELRDDIIAKLQSIQQKCPSYEVEPLIYHVDVAA
MYPNIILSNRLQPVAIVNEQICAGCIFNKDENNCKRNLNWQWKGEYFPLTRKEYEGVKTQ
LEYELEKDNENKPAQYQREINLNTQNEQLLLKQRVKKYCSNVYKHVHQTKIDLKSDTVCM
RENSFYVDTVRDFRDRRYDYKHLVKVWAGKYNEAVQENNALKIEEAKNLMNLYESLQLAH
KIILNSFYGYVMRRGARWYSMEMAAMVTHTGGSIIMDSRSLYDQIGMPLELDTDGIWTLL
PKGFPEQFSFQLSNGKKANFSFICTMSNVLIYDKYGNKQYQTLVDKKTLEYETRTEMSVF
FEIDGPYRAMVIPASKEENKMLKKRYAVFNHAGKMTEVKGFELKRRGELKLIKIFQEEVF
SKFLEGKTLQECYDACGEVAERWYDILDTEGEYVDDSELIEYIGESRFLSKALSEYDGKK
ASMVTCAHRLSEFLGPEIVKGKGINVKFIISRKPVDAKIAQRAIPTAIFEADPNVMKKFL
RKWMKDAGLQDFDMRSIIDWQYYKDRVSSTIQKIITIPAALQKCLNPVPRIQYPDWLHKR
IKVQDEKFKQKDMKYFFKNQVKQPAIRDIEDSAQSSIAKPIQKLSLNSSTNQVNAKKPEI
SAPQDKYGKIEDCPPPEDNFKDWLKYQKSNWRKIRKDIKEEKQVIKQTTVQKSQGLNSFI
RNMDEVVLKSTWHILQISETFEPGVMKVWAMTESGQMFAVKLKIPRTIYINSKTVCEDAD
FKKVQKILPRERKAYHLYEWESSEDTFLEKFHNLTYHHLMNPTVEGVYETKMPLVFKAIT
ELGCLVKPRFNAIPKNEQALGRTYSLKEFEQKQIGADSQYMPSTAFDRIYLLQSQSQNNR
HFWGLFIEQTKEIQFFVVNPVANAKNPALQGQLNYKSLFSNTLQEAGFSTEYINWEISNN
QNTYNELNLCLKAIDQKLIDYKSKVKSATVVVLQSELTPEKLMFMGLPTLANEFPCMKCQ
QVETDQEYPALDWIRFACKNMSIRFTEINDWVRDKINFARYSFVPVCNLDGDSSLFIIDT
LYARNLSQNRHILWYSDTSKPDLGGHEDKDFRIYFQDEIENPEIIQKGFYRNYTVEIDIT
EFALNTILQSEYLKDFEEASMLATQYRQEDKNGNRGEGNFAKVAKQDFDNDLDEYVTCAG
IFKRLRDLVNCWIKDIIEDDQYADRLTHSLYRWITSPTGAKLYDPLLHRLVHQLMKKTFY
QMIYRLKKLGCQVIYANFHKLIIHTQRDTFEEAENFINFVTHTIKQDPMFSFITMTPNEY
YKILLFKDYYNFGGIKESNPSKVSNKWDICLHLPEAIQKKFLITIGEFILKVYKHNKKML
ESGQYDRAHMAAGSNQDNGLKEMMNEDSKKIESYMDTVDDIKKERDHDYIVHVISEYFSQ
KLFPLVGELLAKKEDMNKDDQYEDDDDLDLADHEEGSQDFDDYDQDENDQNFLNQGYAQQ
DNRYVKQRKQRERERKQKELKKWEFPQRIGSYNDYKNAALEFSKQVCKNVFGLDEAFQTQ
VTTLKRNLLSIIREKEFSTTVVSATEPSLILVVPDVICTFCQTSKDLDICRDPSLNKDLH
QNNLTTEQISAENSQWFCQQCDSALNKGLIERRLVELLNRRAVGYQIQDLKCIKCLMVKN
TIVSRYCQCTGQFKATVGYEKPEKLKNSNLLNNITDIKLFVQLMRNFGTYHNMPILKDTA
QQLMILYN