Identifiers and Description

Gene Model Identifier

Contig11781.0.0.g16

Standard Name

POL12

Aliases

Contig11781_0_0_g16

Description

DNA polymerase alpha/epsilon subunit B

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam04042 ) DNA polymerase alpha/epsilon subunit B

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBL035C1.000361553249356e-16POL12 SGDID:S000000131, Chr II
from 153610-151493, Geno...
T. thermophilaTTHERM_006148200.00000000000004998767099442072hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11781.0.0.g16(coding)
ATGGAGGCCTTTGAAGAAATATTTGACGACTTTTCCTAGAGCAATGTAGCTCAGATTTAA
GGTTTGCTAAGCAACTACGGCATATCAGAAGAAGACCTAGTCTACAAGTTTGAAGCCAAA
AAGACTAATTGGCAAACTGAAAATAGTGATCAATTCAATAGATTGGAGGCACCGTTCATG
GAGATCTATCAAATCGTTATGGAAGAGTTATAGAAGGAGAAGCAGAATGCCATTCGTAAA
TCTGGTGCTTAATAAATGGGAACAGCTAATGCTTATGCTACTAAAACTAATCCTCAGCCA
ATTAATAATATGAGAGTGAAAGCTTTAGATAGTCAGGGCAGTTCTTTAATGAAAAATGGA
TAAGAAAAGGCTACTTTGATTCAGAGAATTGTTCAGAGTAAAAAGAACGCTCAAGCAACA
GGATCTAAGCCTTAGAAGATTGAGCATGATATGGATTCACTATACATTTCAAGAAAATCA
AGGGGTGATGTGAGAAACATTTTCAATGAGAAGATTCCTTAATATTAATTCTCAAACAAT
AGAGATGGTTGCTTCAATGTTCAAGTGAACGAAGTTCCCAAATATGACATTCTTAACTTG
ACAAACTTTGAGAGAGTTAACAGCTTGCAGAAGCATTTCGAGATTATCCAAGAGATTATG
AAGCACTAGATTAGAGCAGAGAGTTTCAATGATCTCGGAGATATTGATAATGATTGTCAA
AGAATTATTGGTAGAGTTGTGGCATTTAGTCATGAAGAAGCTAAAATCTCTGAAGGAAAC
ATTGGTCTCATTAATCTATCAGAGGACTAGTAATTCGGTGTATACAAGCTCAAGTTAAAT
TTAAGTGAAGTGAAGAGCTATTCTCTCTTTGAGGGTGAAGTGATAGTTGCGGAGGGTTTC
ATAGATCCTAACACAGCCCAAAAATTCAATGTCACAAGACTTCACAAGCCAGCTCCCCTC
CAACAAAAGTCAGGCATGAATTTAGAGGAAGTGAAATAAATTAGTTATAATAACTATAGA
GATAAACCATTAGGCCTTATGATTGCCAAAGGACCTTATACCTTCACCAAGAATCTTAGT
TACAGTGGATTATATGATTTCTTAGGTGCAGTGAGAAAGAACTAACCTCACGCAGTTATT
ATGATGGGTCCATTTGTCGACTATAATAACTCTGATATTAATGATGGCTGCTTGTTCTAT
GATGGAGAAGGTGGAAAGGTATTTGCATCTTACGAAGAAATCTTTTAGGACCTCGTTGAG
ACTATTGCAAAATAAACAGCAGGTATGAATACCAAGGTTATCTTTGTGCCTTCTCATCTC
GACATTCACCACCTTGAGACTTTACCTTAATAACCTTTCCATCAGAGATATTTTAAAAGC
ATGTTCACTCAAGCTGTGGTTGTAGGAAATCCCTCTACTTTCAGACTAAACGATTTAAAG
ATTGGTGTGATTAATGCAGACATGATCAAGGATATGTGCAGTGGCTTGTTATCAAAGAAT
ATGGATCCTCCCAAAATTGATTTATCTTTAAGAGGCATACTAGAACAAAGAATCATGTAC
CCTGTATATCCACCTTCTAGCTCAGCTGCTATGCTTGACTTAGTGCCAATTGAATTTTCA
TAAATCGATAAACTTATGCTTCATGATGATTTTATTCCAGACATCCTCATCACTCCATCT
GACCTTATCCCCTTTACAAAGGTATTAAAATTCTCAATTAACATAACAATTTATAGAATA
TCGAGGGTTGTGTCTGCATCAATCCTGGTTCAATCATCAAGAATGATCAAGGTGGCACAT
TTTAGCAAATTCTGGTGGAGCCTTTTGATTACATGA


>Contig11781.0.0.g16(protein)
MEAFEEIFDDFSQSNVAQIQGLLSNYGISEEDLVYKFEAKKTNWQTENSDQFNRLEAPFM
EIYQIVMEELQKEKQNAIRKSGAQQMGTANAYATKTNPQPINNMRVKALDSQGSSLMKNG
QEKATLIQRIVQSKKNAQATGSKPQKIEHDMDSLYISRKSRGDVRNIFNEKIPQYQFSNN
RDGCFNVQVNEVPKYDILNLTNFERVNSLQKHFEIIQEIMKHQIRAESFNDLGDIDNDCQ
RIIGRVVAFSHEEAKISEGNIGLINLSEDQQFGVYKLKLNLSEVKSYSLFEGEVIVAEGF
IDPNTAQKFNVTRLHKPAPLQQKSGMNLEEVKQISYNNYRDKPLGLMIAKGPYTFTKNLS
YSGLYDFLGAVRKNQPHAVIMMGPFVDYNNSDINDGCLFYDGEGGKVFASYEEIFQDLVE
TIAKQTAGMNTKVIFVPSHLDIHHLETLPQQPFHQRYFKSMFTQAVVVGNPSTFRLNDLK
IGVINADMIKDMCSGLLSKNMDPPKIDLSLRGILEQRIMYPVYPPSSSAAMLDLVPIEFS
QIDKLMLHDDFIPDILITPSDLIPFTKVLKFSINITIYRISRVVSASILVQSSRMIKVAH
FSKFWWSLLIT