Identifiers and Description

Gene Model Identifier

Contig22794.0.g89

Standard Name

POL1

Aliases

Contig22794_0_g89

Description

DNA polymerase family B

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00136 ) DNA polymerase family B
  • ( pfam08996 ) DNA Polymerase alpha zinc finger
  • ( pfam03104 ) DNA polymerase family B, exonuclease domain
  • ( pfam12254 ) DNA polymerase alpha subunit p180 N terminal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL102W1.9993181170755286e-174POL1 SGDID:S000005046, Chr XIV
from 430087-434493, Geno...
T. thermophilaTTHERM_004247002.0004037638327014e-151DNA polymerase catalytic subun
it

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22794.0.g89(coding)
ATGAGCGATAAGTACACAACACAATCAGGAAGAGAGATTAAGAAAGCAGGTCGTGGAGAT
GCTGCCAAAGGCGCCCTAGCTCAATTGAGAGCTGCTAGAGAAGGAGGAAGCAAAAGAACT
GATCAGTATTAGGTTGATGAAGCCAAGAAAATATTTGATGAGATAGATGACGACGAATAT
GACAAAATTTAAGATCAAAGAAAGAACGATGACTTCATTGTTGACGACGATGGTTATGGT
TACAGAGATCACGGAGGTGAAATTTGGGAAAGAGATGACCACCCTGAAGATGGCGGTAAA
AAGAAAAAGAGAAAGCTCGATCCTAATGAACAGTCAATCACTGCCTTTATGAAGCCAAAG
TCAACTATAAACAGACCAGGAGCTGTGACAAACTCCAGTGCCTAAATCAAGCAAAAACCC
AAGGTTTCAGCTGAGTAGTCAAAGGACATCATGAACAATCTCTTCTAAGAACTTGATTCA
AAGGATGTAGATGAACTCTAAGATGTAAATAATTCAGCAGTTGTTACCGAGCTTAACAAA
CCAATTGCTTTCAATTAGAACGATATGCTGACCTCGAAATATGCAGTTACACTTGAAACT
CGCTAAGAAGTTGAATAGAAGAGGGTCACAGAGCAAATTTAGGCATAAGCCTAGATTGGA
TAGAACCAACAAAGTTCCAATCCATTTTCAAAAAAGAGAAAGTTTGAAGAGATTTCCACT
AACTAAAATGCTCTTGCATCCGATTCCAAAAGAGTTTCAAACTAAACTAATGATAATTTG
AACAAAAGTGGAAACACAAGTTATTTCGATGCTAAAAGTAGCGAATCCTTAAATTAAAGT
GACTTTTAAAGCGCTATGGATGACTCAATGAAAATCGACTAGACTTCAGCTTAGAAAAAA
ACTTAAATTGAATAGACAGTGAACCACAGCAAGACTTTAGAGACATAATCAAAATCAAAT
GATGAGTGGAATTAAGTTAGACAACAAAACTTCTAAGCCAATTAGGAACTTAGAAATATG
GAACCAAGTGTTGGTTAAAATACTCAAGAATTTCCACTTCCTCTAAACGAAAATGGTACA
TTATCATTCTATTGGATCGATGCTCATGAAGAAAATAATGGAACAGATCTGTATATTTTT
GGAAAAATCTATCAACCACAAGTGAGATAATTCGTTTCTTGCTCTATGAAAGTTAATGGA
ATGCAAAGAGAACTCTATGCTCTCCCTAAAATGAGAGGTAAAGCAAGAGGAGCTTTGACT
GTTGAAGAAGAGAAGGAATAAGTAAGAGCTGTAATGATGGAGTTGGATGATATTAGAAAG
AAGAGATTCCCTCAAATTTCAAAATGGAGATGCAAGCCAGTTAATAGAAAGTACGCTTTT
GAAATGCCAATTCAACATGGTGAGCATCAATTCTTGAAAATCAAGTATGATAGCACCATG
CCTCCACTACCAAGCACAATTTAAGGAAACACATTCGAATGCATTTTTGGGTCGACTTAA
AGCATGCTTGAGTTATTCATTTTAAAGAGAAAAATTAGAGGTCCATGCTGGATGACAATC
AAAAACCCTACAAAGGTTACTGATTTCAAGAAAACATGGTGCAGACAGGAAATTGTAATT
GATAACCCAAAGAACGTAGAAGTTACTCTTGAAGACTTAAATAAGTAAGAACTTCCACCT
CTTACATCTCTTACTTTTTCATTTAAAACCACCAGAGCTCAATAAAACACCAATGAAATT
GCTATGATATCATGCTTGATTAATACAAACATTGCTCAAGAAGGACCTTCTCAGGTTGAA
AGAACTCAATCATTCACCTTATTAAGAAAACTTGATGGTAAACCTATGCCTTATGACTTT
GATCAAAAGGTCAAACAAAGAAAGGAAAACATCATTCAAAAGTTTGAAAATGAGAGATAG
ATGATAGAAGCATTTATTGCTAAAGTTTTCATTGTTGATCCAGATCTTGTAGTTGCTCAC
AATTTATGTGGAGGAATGTTTGATTTGTTATTAGCAAGAATTCAATATTTGAAAGTTAAT
CACTGGTCTAGAATTGGAAGACTAAAGAAGACTTAAATCCCTAACAAGAAGCTAGATGTA
GGAGGTTCAAGCTACGGAGGATCTCAATGGATTCCAAGATAAGTCACATGTGGTAGATTA
CTTGTTGATACTTTCCTTTCTGCTAAGGAGCTTGTAAGAGAAACTAGTTATGATTTGACT
TACCTCGCTAAAGTTCAACTAAAGAAAGACAGACAAGACTTTGATGATGAGCTCTTACCA
ACATTATACATTACTTCAGAGAGACTTTTCTCACTAATTGATCACACTGAAAAAGATGCT
TACTTGACTATTTAACTTATGAATCATCTCGCTATTATACCTTTGACCAAGCAGCTTACT
AACATCGCAGGTAACTTATGGTTCAGGTCTCTCTAAAATGCTAGAGCAGAGAGAAACGAG
ATGCTATTATTGCATGAGTTCAAAAAGAAGAAGTTTATTTTACCAGACAAAAAAGCACCC
AACGCTAAAGATTTCAAGCGTAATATGTTTGCAGATGAGTTTGAAGAGGCTGAAGTGGGC
AAGGGACCCAAAAAAGGTGGAAAGAGAAAGAAGGCAGCATATGCTGGTGGTTTGGTTATC
GAGCCTAAAGCTGGTTTCTATGACAATATTATCTTGTTGTTGGATTTCAATTCACTGTAT
CCCAGTATTATTCAAGAGTACAATTTATGCTTCACCACAGTTAATCGTAGACCAACAAAG
AATTTCGATGGGTCTGAAGTTAAAAGCCAATTCAAGGCTGCTGGAACAGATGCTAATGAA
GGCAATGAAGTTGAAGAAGCAGATCTTCCTGATAAGAATGTTAATGTCAAAGACGCTGTA
CTTCCAAATGTCTTAAGAGATTTAGTTTAGAAACGTAAAGCAGTTAAAGAAAAGATGAAG
AACGAGAAGGACGCAGTTAAGCTTTCACAACTGGAAATCAGGTAAAAAGCTATCAAGCTC
ACTGCTAACAGTATGTATGGTTGCCTTGGTTTTGGCTCATCTAGATTCCATGCTTAAGCA
ATTGCTGCCCTAATTACCAAAACTGGAAGAGATACACTGTTAAGAACCAAGGACATTGCT
GAGAATAAATTAGGTTTCAATGTTGTATATGGAGATACTGATTCTATTATGATCAATACT
GGAACAAATTAATTACAATAGTCTTTAGAAATGGGTAAGAGACTCAAGGCAGAAGTTAAT
TGCTTATATAAGTGTCTTGAGATAGAAATCGATGGTGTGTTCAAGAGTCTACTACTTCTT
AAGAAAAAGAAGTATGCTGCACTTAAATATGAGGGTTTTGGCACTCCAGATGCTAAAGTA
GTTTAGGAAGTTAAAGGTCTAGATATGGTTAGAAGAGATTGGTGCCCACTTTCAAAGAAT
GTTGGTAACTTTGTGCTCAATCAAATTCTATCCGGAAAACAAAGAGAAGATGTTGTGCTT
AACTTAAATGAATATTTGTCTGATATTGGTGAAAAGATGAAAAATAATGGAATCACCTTG
GATCAATTTATCATTACAAAACAACTTACTAAGGCAATCTCTGAGTACTCAGATATCAAG
GGACAACCACATGTCGCGGTTGCTCAAAGACTTAAGAATCAAGGAAAGAGTGAATCAGAT
CTAGTGAACAACTTTATCCCTTATGTAATTGGTGCTTAGCCTTTTGATCCAAGCAAAACT
AACCCAGCATTGGCAGACAAGGCATATCACCCTGAAGAGGTTGTCTCCTCTAAAGGAAAA
ATCTTGCTAGATATTGAGTGGTACATCACTATGCAAGTCTTGCCACCTATTACCAGACTT
ATCGAACACATTGACGGTATTGATGTGGAATTTGTTGCTTAATGCCTAGGAGTAGATCCT
AAAAAGTATAAGTATCACAGTTCAGAGAAGAAAACTGGAGAAACCAATAATGATGATGGA
ACATTGATTTAGAATCCAATCTTGTAAACTGAAACTGAAAGAAGTTTAAAGGGAAGAACT
ATAGCTGAGTTGACAATTAAATGTCCACACTGTTCTGAAAGCTATCACTTCCCAGGAATC
TTCCAAGATGGCAAGAACAATGCTCTCTCAGGTTTACTCTGCATAAAATGCACCTAGCCA
ATTCCAGAAGCCTACATTCAAAACCGCGTCACTCTTTTCTTAAAGCAGCTCTTAACTTTA
TACTATCAAGGTAACAAGCAATGCCAAGAGCCAGCATGTGGTGCAGTTTCTCGCTAACTT
CTCTATAACAACAAATGCATTAATTTAGCTTGCAAGGGAAAAATGATACCAGAATATACT
GAATAAAAGACTAATGATACTCTCAGATATCTATAAGGCTTGTTTAATGTAAAGAAGTAC
ATCCAAGAAAATCAGAAAAACGGTTGTGTGCATAAAACCGTAGAGGAAGTACCTAATTTC
GATGCATTTGCCAGAATGCAAGGAAAAGTCGATGATATTATGATTCGCAGCAAATATAAC
AAAGTAGACCTCAGCAGCATATTCAACTTCATGAAGCTTGGAAAGTAACAATGA


>Contig22794.0.g89(protein)
MSDKYTTQSGREIKKAGRGDAAKGALAQLRAAREGGSKRTDQYQVDEAKKIFDEIDDDEY
DKIQDQRKNDDFIVDDDGYGYRDHGGEIWERDDHPEDGGKKKKRKLDPNEQSITAFMKPK
STINRPGAVTNSSAQIKQKPKVSAEQSKDIMNNLFQELDSKDVDELQDVNNSAVVTELNK
PIAFNQNDMLTSKYAVTLETRQEVEQKRVTEQIQAQAQIGQNQQSSNPFSKKRKFEEIST
NQNALASDSKRVSNQTNDNLNKSGNTSYFDAKSSESLNQSDFQSAMDDSMKIDQTSAQKK
TQIEQTVNHSKTLETQSKSNDEWNQVRQQNFQANQELRNMEPSVGQNTQEFPLPLNENGT
LSFYWIDAHEENNGTDLYIFGKIYQPQVRQFVSCSMKVNGMQRELYALPKMRGKARGALT
VEEEKEQVRAVMMELDDIRKKRFPQISKWRCKPVNRKYAFEMPIQHGEHQFLKIKYDSTM
PPLPSTIQGNTFECIFGSTQSMLELFILKRKIRGPCWMTIKNPTKVTDFKKTWCRQEIVI
DNPKNVEVTLEDLNKQELPPLTSLTFSFKTTRAQQNTNEIAMISCLINTNIAQEGPSQVE
RTQSFTLLRKLDGKPMPYDFDQKVKQRKENIIQKFENERQMIEAFIAKVFIVDPDLVVAH
NLCGGMFDLLLARIQYLKVNHWSRIGRLKKTQIPNKKLDVGGSSYGGSQWIPRQVTCGRL
LVDTFLSAKELVRETSYDLTYLAKVQLKKDRQDFDDELLPTLYITSERLFSLIDHTEKDA
YLTIQLMNHLAIIPLTKQLTNIAGNLWFRSLQNARAERNEMLLLHEFKKKKFILPDKKAP
NAKDFKRNMFADEFEEAEVGKGPKKGGKRKKAAYAGGLVIEPKAGFYDNIILLLDFNSLY
PSIIQEYNLCFTTVNRRPTKNFDGSEVKSQFKAAGTDANEGNEVEEADLPDKNVNVKDAV
LPNVLRDLVQKRKAVKEKMKNEKDAVKLSQLEIRQKAIKLTANSMYGCLGFGSSRFHAQA
IAALITKTGRDTLLRTKDIAENKLGFNVVYGDTDSIMINTGTNQLQQSLEMGKRLKAEVN
CLYKCLEIEIDGVFKSLLLLKKKKYAALKYEGFGTPDAKVVQEVKGLDMVRRDWCPLSKN
VGNFVLNQILSGKQREDVVLNLNEYLSDIGEKMKNNGITLDQFIITKQLTKAISEYSDIK
GQPHVAVAQRLKNQGKSESDLVNNFIPYVIGAQPFDPSKTNPALADKAYHPEEVVSSKGK
ILLDIEWYITMQVLPPITRLIEHIDGIDVEFVAQCLGVDPKKYKYHSSEKKTGETNNDDG
TLIQNPILQTETERSLKGRTIAELTIKCPHCSESYHFPGIFQDGKNNALSGLLCIKCTQP
IPEAYIQNRVTLFLKQLLTLYYQGNKQCQEPACGAVSRQLLYNNKCINLACKGKMIPEYT
EQKTNDTLRYLQGLFNVKKYIQENQKNGCVHKTVEEVPNFDAFARMQGKVDDIMIRSKYN
KVDLSSIFNFMKLGKQQ