Identifiers and Description

Gene Model Identifier

Contig18087.0.g110

Standard Name

PNUTSa

Aliases

Contig18087_0_g110

Description

Zinc finger C-x8-C-x5-C-x3-H type (and similar)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and similar)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18087.0.g110(coding)
ATGGTGAAAAAACAGATTGCTGATTGTAAATAAATCAATGAGCAGAAGAAAATCTTGGCT
GCTTAATAAGCTTAGCTGGCTCCACCTCCTGTTCCTGCTGGACCATAGCCAATTGTTGCA
AAACCCTTTAGGACTGTTCCATGCAGAAATTATCATGGTCCTGTCGGCTGCACAAGAGGA
GAGTTTTGCCATTTTATTCATGCTGTAGGTTACGAATAAAGAGAAATACCCCGTGATGTG
TTTATGAAGATCAGAAACGAAAATATGAGAAAGAATCTCCTTGATGAAATCAGAGAAAAG
AATCCTCAAGCTAGTATGATGCTACAAAACTCATCATATATGGAGATTCAAAACTTTGTG
AAGTAATATAATGAATCAATCGGAGCTGTAGTGCCTACAAGCACACCCGTGCAACCTAAT
TAAGGGCAATCCAACTAAATAAATGTTAATCCTATGATGTAAAACCCAAATGCAAATATT
CAAAGACCAAATGCTCCTATGAACATGGGCATGTAAGGCAACATAGGCATGATGAACTAA
AATACTAGGATGCCAAATTAACAAACAGCAATGATGGGAGCTGGCTTTAATTAATAGCAA
TAAGTTAGGCAAAACTTCCCTAATTAAATGAACCCTATGATGAATTAAAATATGATGGCA
AATAACATGATGGGTTAAAACATGCAGCGTCCTCCTGTGATGCAAAGTGTCGAACAATCT
TAAGCACCAGGCATGATGAATCCTCAATAAATGATGGCTGCTATGGCCTAAATGAATCCT
ACTTTAGCTGCAAGCATGATGAACATGAGTCCTCAATAACAAGCAGTTATGATGCAGTAA
ATGATGGCAGCTCAATAACAGCAACAAAGAATGAGCATGCAAGCTGCTAATATGGGCGGC
GCAAATCCTGGCATGATGAACTAAATGATGTACCGTTAGCAAGCACCTCAGAATAATCCC
ATGGGTATGATGGGAGGAGGAGCTGGAATGTTCATGCCAAACCAGTAGCAACAGCAATAA
CAGATGAATATGGGAGGTGGCCAAGTGCTCTAACCATCTATGAGCAACGACAATAATAAT
TTAACATCTCCAAACTAAAATAATTAGTAGAATTAACAATAGTGA


>Contig18087.0.g110(protein)
MVKKQIADCKQINEQKKILAAQQAQLAPPPVPAGPQPIVAKPFRTVPCRNYHGPVGCTRG
EFCHFIHAVGYEQREIPRDVFMKIRNENMRKNLLDEIREKNPQASMMLQNSSYMEIQNFV
KQYNESIGAVVPTSTPVQPNQGQSNQINVNPMMQNPNANIQRPNAPMNMGMQGNIGMMNQ
NTRMPNQQTAMMGAGFNQQQQVRQNFPNQMNPMMNQNMMANNMMGQNMQRPPVMQSVEQS
QAPGMMNPQQMMAAMAQMNPTLAASMMNMSPQQQAVMMQQMMAAQQQQQRMSMQAANMGG
ANPGMMNQMMYRQQAPQNNPMGMMGGGAGMFMPNQQQQQQQMNMGGGQVLQPSMSNDNNN
LTSPNQNNQQNQQQ