Identifiers and Description

Gene Model Identifier

Contig17338.0.g95

Standard Name

PNO1

Aliases

Contig17338_0_g95

Description

KH domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004569004.001839059848271e-97hypothetical protein
SGDYOR145C2.9991172563576427e-86PNO1 SGDID:S000005671, Chr XV
from 606171-605347, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17338.0.g95(coding)
ATGGAATCAAAATAAAAGAAAGTTCAATTAGAAGAAACAAAGAAGGTGCTTGTTGAGAAT
ACCAATTCCACTGTTGATCAGACCAGTCAAGACCCAACCTTCGCAGGTGTCGATGAAGAC
ATGGAGTTAGATCAGGAAGATCAAGCAGAGCTCATGAAGTTTGAGACAGTTCAACAGTCT
AAAGAGATTGAATTCGACAAGATTAAGCCTTCAGACTTAGGAGTCAAGAATGAATATAGA
AGGATTCCAGTACCCAGACATAGGTACACCCCACTTAAGTAAAACTGGGATAGTATATTG
AAGACTCTCGTTGAACACATGAAGTTGCAAGTTAGAATGAACACAAAACGTAGATGCATT
GAAATAAGAACATCAAACAAGACAGAAGACATTGGTGCAATCTAAAAATCAGCTGATTTC
TTGAAGGCCTTCATGCTCGGTTTCGAAATCTAGGACGCTGTAGCTATTTTAAGATTAGAC
GATCTTTATCTAGAGACCTTCGAAATAAAGGATGTAAAGAGTCTCCATGGAGACCACTTG
AGCAGATGTATCGGTAGAATATGCGGAGAGAAGGGTAAAACTAAGTACTCAATTGAGAAC
GCTACTCGTTCAAGAATCGTGGTTGCTGACTCTAAAATTCACATCCTCGGCTGCTTCAAC
AATATTCAGTTCGCCCGTGATGCCGTCTGCAGTTTAATCTTGGGTAGTCCCCCAGGTAAA
GTCTACTCCAAACTTAGAACTGTCAGCAAGAGATTGGCTGAGAGGTTCTGA


>Contig17338.0.g95(protein)
MESKQKKVQLEETKKVLVENTNSTVDQTSQDPTFAGVDEDMELDQEDQAELMKFETVQQS
KEIEFDKIKPSDLGVKNEYRRIPVPRHRYTPLKQNWDSILKTLVEHMKLQVRMNTKRRCI
EIRTSNKTEDIGAIQKSADFLKAFMLGFEIQDAVAILRLDDLYLETFEIKDVKSLHGDHL
SRCIGRICGEKGKTKYSIENATRSRIVVADSKIHILGCFNNIQFARDAVCSLILGSPPGK
VYSKLRTVSKRLAERF