Identifiers and Description

Gene Model Identifier

Contig20238.0.g39

Standard Name

PLRG1

Aliases

Contig20238_0_g39

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006844501.0001999920370885e-161hypothetical protein
SGDYPL151C5.999773492405769e-126PRP46 SGDID:S000006072, Chr XV
I from 267535-266180, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20238.0.g39(coding)
ATGGAGAACAAAAAGCGCACATACCAAATGTTTCTTGGACAGATTGAAGATAGGATACCT
GAAATAGAGGAGATAGTTCGCTTGAAATTTGAAAACAAAATCAAGAAGCACTACACAGAC
ATTGGAAAGACTCCAGGCATCTTGATTGAAGAGAATAAGAGAAGAAAGCTGCTACGAGAC
TTGGGAGTTGAAGAGAAAATTCAAGAAGTTAAAATGCTATAGCAAGATCAAATCAAATAA
GTTGAACCTTAGATTGAAGAGGTAAAAGGCTAAATGCCAGATTTGACAAATGTTAGCTCA
AAGGCAATTCAAAGCATTGAGAGGGAAAAGAATGATGTGCTCAATATGATTCCTGCTAAG
TATAGAGTCTCAAGCACTGACTAAAAGGCATCTACTTCTACAGCTCTTAGTCTAGTAAAT
GCTATGCAAAATAATCAGAGTGCAATTGCATTAAGGCAAAGAAAAATTGTTCAACCACAG
TGGCATGCACCTTGGAAACTTATGAGAGTCATTAGTGGACACATGGGATGGGTAAGAAGC
ATAGCAATGGATCCTATGAATAGATTCTTTGTGACAGGATCAAATGATAGAACAATTAAA
TTCTGGGATTTAGTGGAAGGAAAGCTAAAAATCACACTTACTGGTCATATAAACACAGTA
AGAGGACTTGTAGTTTCTGACAGGCATCCTTATTTGTTTTCTTGTGGTGAAGATAAGAAA
GTTCTTTGTTGGGATTTGGAGCAGAATAAAGTTGTTAGACACTACCATGGACATTTGAGT
GGTGTTTATTCTATCGCTCTTCACCCTGAGCTAGATATCTTAGTTACTGGAGGAAGAGAT
TCAACTGCAAGAATGTGGGATATGAGAACAAAGGCTTAAATTCATTGTTTAGGCGGTCAC
GGAAATACAGTTGAGGATATCCTTTGCTAAGCAGATGAACCTTAGATAATTACAGGTTCT
CACGATAAAACAGTCAGACTATGGGATATAAGAACTGGATCGTCTCTCAAAACTCTTACT
AATCATAAGAAAGGAATTAGAGCACTAGCCATGCATCACGAAGAATATACTTTTGCCTCT
GCAGCATCTGATAAAATAAGAATCTGGAAACTTCCAGAGGGAGAGCAACTCAGAACTATT
CCTGAGCATAATGCTGTTATTAATGCATTAGCTGTTAATAAGGATAATGTATTGGTCTCA
GGAGGAGATAATGGAACTCTGTATTTCTTTGACTGGAAGAGTGGTCACAATTTCCAATAA
ATTAAGACTTAAGTCTAGCCAGGTTCGTTAAGTTGTGAAGCAGGAATCTATGACATCAAA
TTTGATAAGAGTTCTCTGAGAATGATTACAGCTGAATGCGATAAAACCATTAAAATTTAT
AAAGAGGATGAAGAAGCTACTCCAGAGACTCATCCAATTGAGTTTGATCCAAAAGACTTT
TGA


>Contig20238.0.g39(protein)
MENKKRTYQMFLGQIEDRIPEIEEIVRLKFENKIKKHYTDIGKTPGILIEENKRRKLLRD
LGVEEKIQEVKMLQQDQIKQVEPQIEEVKGQMPDLTNVSSKAIQSIEREKNDVLNMIPAK
YRVSSTDQKASTSTALSLVNAMQNNQSAIALRQRKIVQPQWHAPWKLMRVISGHMGWVRS
IAMDPMNRFFVTGSNDRTIKFWDLVEGKLKITLTGHINTVRGLVVSDRHPYLFSCGEDKK
VLCWDLEQNKVVRHYHGHLSGVYSIALHPELDILVTGGRDSTARMWDMRTKAQIHCLGGH
GNTVEDILCQADEPQIITGSHDKTVRLWDIRTGSSLKTLTNHKKGIRALAMHHEEYTFAS
AASDKIRIWKLPEGEQLRTIPEHNAVINALAVNKDNVLVSGGDNGTLYFFDWKSGHNFQQ
IKTQVQPGSLSCEAGIYDIKFDKSSLRMITAECDKTIKIYKEDEEATPETHPIEFDPKDF