Identifiers and Description

Gene Model Identifier

Contig3597.0.g88

Standard Name

PITR1b

Aliases

Contig3597_0_g88

Description

Phosphate transporter family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

  • inorganic phosphate transmembrane transporter activity (IEA) | GO:0005315

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR296C9.998720540547892e-23PHO89 SGDID:S000000500, Chr II
from 798522-796798, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3597.0.g88(coding)
ATGGCTATCCCTGATCAAATATACTTATGGACTATGATAGTTCTTGGTTCACTTTTGAGT
TTCTCAATAGGTTCGAATGAAACAGATGCGCTTGCCACTACTTACAGCAGTGGCTCGCTT
ACTCTCAAGCAATGCCTACTCCTTGGAGGAATCTTTGAGTTTATAGGAGCATTTTATTGC
TCTAAACAAGTCAGTACTACCTTATCTCAAAACATAATTCAAAACTTTAACAAGATTCCT
CTTGAAATCCAAAAATCCATGATGCTTTCAGTAACTATAAGCACTGTTGGCTTCACTATT
TTATCATCAGTTATGGGATTCCCTATCTCAGGAACTCACTCTATGGTAGGCGCTCTGCTT
GGAGCAGGATTAATAGGAGTTGGCATTAGTAACTTAAATTCTACACAGCTATAATAAATT
GTTTTGTCATGGTTCCTATCCCCATTAGTTTCTGCATCTTTAACATGCATCATTCTGGTT
TTTGTCTGCAAGTACATTCTAAATCACTAAAACTTTTCTTTCAAAGTTAGAATGACGATG
GCATCAACTCTTTCAGGAATTGCTTTCTCGACAATCCTAATTTTAACATCATCTTTGATA
TTTGATAAAATGTTTATGTTATAAGGATGGAACTCCCTCTACTTGCTTGTATCCTTTTAT
GCAGGCTTTGCTTATTCAAGACTCGCAATATTGAACCATTTCAATAAACTTCAAAAGGAT
GAGATTTTAACCTCCATTTTTAAGCCATGGAGCACAGATTTCATAGAAACCCTCGTGCCT
GTTGCAAGATTCGAAGGTGCTAAAGAATCTCTCCTTTCTCAACTAAGTGAAGAGGACAGA
TAAAACAAGTAAAGACTTAACTTTTACAGATCTCTTAGTACCAGCTCAGCTTATATAGGA
AGAACTGAGAGAAGTGAGACTATTATATCAAAAGGCTCATAGAAAGATCTAGTTTTAAAT
TCAAACAACTATCAGGAACTGTAAATGAAAAATGAGAGATCTCCATCAATAATCATTCCA
TAAGCTTTTGATAAATACTATCCACCACATGAAACCAAAATAAAAACTTTACCTCTTAAC
ATAAAAACCAAAGAAATAATCGAGGAACAATTGACTATTGTGTTTAAATACTTAAACATA
ATTACTACCTTCCAGTTTTGTATTGCAAATGGATCTCATAACATAGCCAATTCTATTACA
CCACTCTTAAGCACATTCAAAATCTTTGGATATGACTAAGAAATTGTGTATTTGATTGGT
TCAATCACTATGGCACTTGGACTCATGACTTTGGGAGGTAGAGTGCTTGAAACAATTGGA
AAAAAGGTTATTTAGCTCGATTACCAGAAAGGATTTTGCTCTCAATTTGCTACATCGATC
TCCATAATGGTTGGCTCTTATATGGGACTTCCTTTATCTTCGACTCATTGTAGTATTGGA
TCCTTAATTGGGCTATCTCTTGCCAATTATTTTACTTCAGTTTAAAAAGTTTACCCAGAT
TCAGAGTAAAAGCCAGAAAATTAACTCAATTTTAAGGTAATGGGAAAAATCTTTGCCTGG
TGGATAGTCACTATTCCCTTCGTTTTTTGCACAACTGCTTTCTTAACTTAATCAATAATC
GGTTGA


>Contig3597.0.g88(protein)
MAIPDQIYLWTMIVLGSLLSFSIGSNETDALATTYSSGSLTLKQCLLLGGIFEFIGAFYC
SKQVSTTLSQNIIQNFNKIPLEIQKSMMLSVTISTVGFTILSSVMGFPISGTHSMVGALL
GAGLIGVGISNLNSTQLQQIVLSWFLSPLVSASLTCIILVFVCKYILNHQNFSFKVRMTM
ASTLSGIAFSTILILTSSLIFDKMFMLQGWNSLYLLVSFYAGFAYSRLAILNHFNKLQKD
EILTSIFKPWSTDFIETLVPVARFEGAKESLLSQLSEEDRQNKQRLNFYRSLSTSSAYIG
RTERSETIISKGSQKDLVLNSNNYQELQMKNERSPSIIIPQAFDKYYPPHETKIKTLPLN
IKTKEIIEEQLTIVFKYLNIITTFQFCIANGSHNIANSITPLLSTFKIFGYDQEIVYLIG
SITMALGLMTLGGRVLETIGKKVIQLDYQKGFCSQFATSISIMVGSYMGLPLSSTHCSIG
SLIGLSLANYFTSVQKVYPDSEQKPENQLNFKVMGKIFAWWIVTIPFVFCTTAFLTQSII
G