Identifiers and Description

Gene Model Identifier

Contig3572.0.g77

Standard Name

PITR1a

Aliases

Contig3572_0_g77

Description

Phosphate transporter family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

  • inorganic phosphate transmembrane transporter activity (IEA) | GO:0005315

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR296C9.998720540547892e-23PHO89 SGDID:S000000500, Chr II
from 798522-796798, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3572.0.g77(coding)
ATGATAGTTCTCGGGTCAGTTTTAAGTTTCTCAATTGGTTCGAATGAGACAGATGCGCTT
GCCACGACTTACAGCAGTGGTTCACTTTCTCTCAAATAATGCCTACTCCTTGGAGGAATC
TTTGAGTTTATAGGAGCATTTTATTGCTCTAAACAAGTCAGTACTACCTTATCTTAAAAC
ATAATCCTAAACTTTAACAACATTCCTCTTGAAATTCAAAAATCCATGATGCTTTCAGTA
ACAATAAGCACTGTTGGCTTCACAATTCTATCATCAGTTATGGGATTCCCTATCTCAGGA
ACTCACTCTATGGTAGGCGCTCTTCTTGGAGCAGGATTAATAGGAGTTGGCATTAGTAAC
TTAAATTCTACACAGCTATAATAAATTGTTTTGTCATGGTTCCTATCCCCATTAGTTTCT
GCATCTTTAACATGCATCATTCTGGTTTTTGTCTGCAAGTACATTCTAAATCACTAAAAC
TTTTCTTTCAAAGTTAGAATGACGATGGCATCAACTCTTTCAGGAATTGCTTTCTCGACA
ATCCTAATTTTAACATCATCTTTGATATTTGATAAAATGTTTATGTTATAAGGATGGAAC
TCCCTCTACTTGCTTGTATCCTTTTATGCAGGCTTTGCTTATTCAAGACTCGCAATATTG
AACCATTTCAATAAACTTCAAAAGGATGAGATTTTAACCTCCATTTTTAAGCCATGGAGC
ACAGATTTCATAGAAACCCTCGTGCCTGTTGCAAGATTCGAAGGTGCTAAAGAATCTCTC
CTTTCTCAACTAAGTGAAGAGGACAGATAAAACAAGTAAAGACTTAACTTTTACAGATCT
CTTAGTACCAGCTCAGCTTATATAGGAAGAACTGAGAGAAGTGAGACTATTATATCAAAA
GGCTCATAGAAAGATCTAGTTTTAAATTCAAACAACTATCAGGAACTGTAAATGAAAAAT
GAGAGATCTCCATCAATAATCATTCCATAAGCTTTTGATAAATACTATCCACCACATGAA
ACCAAAATAAAAACTTTACCTCTTAACATAAAAACCAAAGAAATAATCGAGGAACAATTG
ACTATTGTGTTTAAATACTTAAACATAATTACTACCTTCCAGTTTTGTATTGCAAATGGA
TCTCATAACATAGCCAATTCTATTACACCACTCTTAAGCACATTCAAAATCTTTGGATAT
GACTAAGAAATTGTGTATTTGATTGGTTCAATCACTATGGCACTTGGACTCATGACTTTG
GGAGGTAGAGTGCTTGAAACAATTGGAAAAAAGGTTATTTAGCTCGATTACCAGAAAGGA
TTTTGCTCTCAATTTGCTACATCGATCTCCATAATGGTTGGCTCTTATATGGGACTTCCT
TTATCTTCGACTCATTGTAGTATTGGATCCTTAATTGGGCTATCTCTTGCCAATTATTTT
ACTTCAGTTTAAAAAGTTTACCCAGATTCAGAGTAAAAGCCAGAAAATTAACTCAATTTT
AAGGTAATGGGAAAAATCTTTGCCTGGTGGATAGTCACTATTCCCTTCGTTTTTTGCACA
ACTGCTTTCTTAACTTAATCAATAATCGGTTGA


>Contig3572.0.g77(protein)
MIVLGSVLSFSIGSNETDALATTYSSGSLSLKQCLLLGGIFEFIGAFYCSKQVSTTLSQN
IILNFNNIPLEIQKSMMLSVTISTVGFTILSSVMGFPISGTHSMVGALLGAGLIGVGISN
LNSTQLQQIVLSWFLSPLVSASLTCIILVFVCKYILNHQNFSFKVRMTMASTLSGIAFST
ILILTSSLIFDKMFMLQGWNSLYLLVSFYAGFAYSRLAILNHFNKLQKDEILTSIFKPWS
TDFIETLVPVARFEGAKESLLSQLSEEDRQNKQRLNFYRSLSTSSAYIGRTERSETIISK
GSQKDLVLNSNNYQELQMKNERSPSIIIPQAFDKYYPPHETKIKTLPLNIKTKEIIEEQL
TIVFKYLNIITTFQFCIANGSHNIANSITPLLSTFKIFGYDQEIVYLIGSITMALGLMTL
GGRVLETIGKKVIQLDYQKGFCSQFATSISIMVGSYMGLPLSSTHCSIGSLIGLSLANYF
TSVQKVYPDSEQKPENQLNFKVMGKIFAWWIVTIPFVFCTTAFLTQSIIG