Identifiers and Description

Gene Model Identifier

Contig17085.0.g20

Standard Name

PINX1

Aliases

Contig17085_0_g20

Description

G-patch domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01585 ) G-patch domain
  • ( pfam12656 ) DExH-box splicing factor binding site
  • ( pfam02862 ) DDHD domain
  • ( pfam10220 ) Uncharacterized conserved protein (DUF2146)
  • ( pfam06459 ) Ryanodine Receptor TM 4-6
  • ( pfam02724 ) CDC45-like protein
  • ( pfam02932 ) Neurotransmitter-gated ion-channel transmembrane region
  • ( pfam04851 ) Type III restriction enzyme, res subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002950609.998720540547892e-23G-patch domain containing prot
ein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17085.0.g20(coding)
ATGTCAAGGAAGTATTTTGATAAGCTGATGACTGGCAGTGGAGTCACTGGCAAGAAAGTC
ACCTCTAAATTCGGAGAAAGCATGATGAAAATGATGGGCTGGCAAGATGGAAAAGGGCTT
GGAAAGAAAGAATCAGGTGAAACTGAAGTTATCCAAATCAAACGTCGTGAAGAGGGTATG
GGTTTAGGAGTCACAAACTCCAGTCCAGCTGTGACATTTAAATGGAGTGATCAATTTTGG
GTTGATGTATACAATAAGGCTGCTAAGAATTTCCAAACTGAGAAAAAGGGCAAAGAAACC
AAGGATAAAAAGAAAAAGAAATAAGTAGTAGAAAGCAGTGATTCAGAATCAAGTGATGAT
GATTTCGATGGGCACATTGTAATCCAAAAAAGCACAAAATCCAAGCCAATTAAGAAAGAA
GAAAAAGCATCAAAGAAAAAGGACAAATCTGATGATAAAAAGAGCAAAAAAGATAAGAAA
TCAAAGAAAGAGAGAAAAGAAAGTATTGCAAGTAGATTGAGAAGCCGATCTCCTTCACAT
GCTGGGTTAGGAGCTGCTAGTGGTAAGAGAAGCAGATTAAATAGCTAAGTTTGA


>Contig17085.0.g20(protein)
MSRKYFDKLMTGSGVTGKKVTSKFGESMMKMMGWQDGKGLGKKESGETEVIQIKRREEGM
GLGVTNSSPAVTFKWSDQFWVDVYNKAAKNFQTEKKGKETKDKKKKKQVVESSDSESSDD
DFDGHIVIQKSTKSKPIKKEEKASKKKDKSDDKKSKKDKKSKKERKESIASRLRSRSPSH
AGLGAASGKRSRLNSQV