Identifiers and Description

Gene Model Identifier

Contig20847.0.1.g97

Standard Name

PIH1D1

Aliases

Contig20847_0_1_g97

Description

pre-RNA processing PIH1/Nop17

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam08190 ) pre-RNA processing PIH1/Nop17
  • ( pfam00993 ) Class II histocompatibility antigen, alpha domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001906301.9994920269952867e-34hypothetical protein
SGDYHR034C0.0000029996948234116693PIH1 SGDID:S000001076, Chr VII
I from 177999-176965, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20847.0.1.g97(coding)
ATGAAGCTCTATTAATAAATTGTGAATGGGTAGGTGCCTCCAGAGCTACAGACTCACTAC
GAGAACTTCACTGATAAAAATGGCAATCCTATTGTCGACGCAGAGGGAGGAGCTATGATT
CAACCTATCCCTGGATTCGTTGTCAAGACAAAGGATTCAACAGGTTAGAAAGTATTCATT
AATATGACTACTCATGATCTTGTTGATCCATTTGAAGAAAAAGCAATTCCAGAAGGAGAT
AGGGAGAAATTTGATAACTCTGAAACCGGTATCCGCATCCCTCTATCAATGGGATTACTG
AGGGAAGATTTTGATAAAAAGGGCGGAATGGCTCAAGTCTGTGATGTCATTTGGAATCCA
AAAACTGTTGAGAGATGCAAGACAGATGCTTAGTTTAGGTAGGTTGTTGTGGAATTAGCG
TTCAATTACTATAACCAGAAGTTTGGACAGGAATTAGACTTGAGATTTACTCTCCCAAAA
ATGAAGTACAAGGGTAAGACTATATAGTATCAACGAATCAGAGCTAAAAAGGGTCCCAAA
ATTTAAGAAATGGAGATTTCTGAAGAAGAGAGAAAAAGATTAGAAGCTAAAGGACTTGAG
CAAGTGAAAGCCAAGAATAAAGTACAAGAAGTTGTCGAGTAGACACCAGATTGGTAACTT
TACTGTGTCCTCAGTCAAGACGATCAATCCAAGAAAGAATACTTGGAGTAATTCGATAAA
GAGGAGTTTTGGACTAAACTATCAAATGATTTGATATAGAGATCAGAAAGTGAGGGAGTA
GGGGACTCACTTGATCGTCTACAGACACTCTCTGAGTAGTTCCGTCTCCCAACTGAGGAG
GATTTAGTTGAGGAATATGATGGCACTAATCATTCCCTCGCTTAAAAGTTAATATTCGTT
GTATCTCTCCCCATCTTGAAGCATTCTCTGGCTTTGAAGATAAAAATGGTTGGTTAGGAT
ATAATTACAGTACGCGTACCTCACTTATACAAATTGCAATTAGGTCTACCCATTGAGGTA
AATAGCCACACTGTTAAGTCTTACTTCGACTGCAAATTGAGAAAATTATTCATAATACTC
TCCAGACCCACACAAGACACAGCAACAATAGAATTTAACTCAGATGTGTAACAAGAATAA
TCATCATCAAACATAAAGCCAATCGAGTTGGTTGACACTAAGAAACTAGAGAGTGATTTA
TTGTTTGATGTTATTTGA


>Contig20847.0.1.g97(protein)
MKLYQQIVNGQVPPELQTHYENFTDKNGNPIVDAEGGAMIQPIPGFVVKTKDSTGQKVFI
NMTTHDLVDPFEEKAIPEGDREKFDNSETGIRIPLSMGLLREDFDKKGGMAQVCDVIWNP
KTVERCKTDAQFRQVVVELAFNYYNQKFGQELDLRFTLPKMKYKGKTIQYQRIRAKKGPK
IQEMEISEEERKRLEAKGLEQVKAKNKVQEVVEQTPDWQLYCVLSQDDQSKKEYLEQFDK
EEFWTKLSNDLIQRSESEGVGDSLDRLQTLSEQFRLPTEEDLVEEYDGTNHSLAQKLIFV
VSLPILKHSLALKIKMVGQDIITVRVPHLYKLQLGLPIEVNSHTVKSYFDCKLRKLFIIL
SRPTQDTATIEFNSDVQQEQSSSNIKPIELVDTKKLESDLLFDVI