Identifiers and Description

Gene Model Identifier

Contig17773.0.g43

Standard Name

PHRF1e

Aliases

Contig17773_0_g43

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001069105.0013199114200274e-20hypothetical protein
SGDYLR247C0.000030009396760408108IRC20 SGDID:S000004237, Chr XI
I from 633354-628684, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17773.0.g43(coding)
ATGATTACTCCTACTAAGAGAGAAGACAAGGAGGTCACCATGAGTTAGCAGTTTTCATAA
CTCTCCCCAGACATGGAGTCAATTTTAAAGAATCGTAGAATGAGGAAAATTCTAAGAAAA
ACTTAGTAAAAAACTGAGAAGGAATCAAACTGTGAATTTGACGAAGAGCATGAAGAAGAA
CTATACAAGAATAGATGTACAGTATGTTTAGAGGATATCCATTTTAAAGCCTAACCAAAC
GAATGCGTTCATATATTTTGCTAAAGCTGTATTTAAGCCTGGACTAAGTTCTCTAATCTG
TGCCCGTTGTGCAAAAGTGAGATAAAAATACTGAATTTGTTTGACTAGAAAGGTGATTTT
TAAGAATCAATAAAGATCGAAAAACCTTAAGCATCAGAGGAGTAGTTATAGGAATGGGTT
TAAGAATTCGCAGAAAGCTGTTATATTTGTTGTTCTGGAATAGACGAAAATTTGATGTTG
GTTTGTGATGAATGCAACTTCAATGTAGCGCACACTTATTGCTTGGATCTACCTGAAGTG
CCTGAAGAAGACTGGTATTGCTCGTAATGCGCAGAATAACGTTAGACTGCTGAATAGATG
CGAGTAAAGAAGCTGAAAATGAAGAAATAACTCCAAAAATAAAAGAAATCTAACAAGAAA
GTTAAATACACTAAGTCTCAATAAAGGAATAAATCAGAAGATAGAATAAATCTTGGTTCA
TTTGATTTAACAAAGCATTTGAAATAGAATTCTGAACTTTATGGAGATGATGAAGAAGAA
GATGTTACAAGCTTCAAATTTAACACAAAAATGAATTTAGATCAATTTAGTTCATAAAAT
AAAGCAAGGTTTGGTTTTTCAAAAAAAATATAATACTAAGATAGCTAAAAATGTATTACT
TCATCTATTGAGGAATAGAGTGCAGGGAGCTACAAACACTTGAAAAACATTTAGAATAAG
CAAATCCTCAATAAACAGCAGAGGAAGCAACAAATTTACAGTATAGATTCATCAATAGAC
ATGTCTCAACCTAAAAGATTCAAGCAGACGGACTATGTATTGAAAAGAAGCGACAGGAGT
AGTTGCTAACAAAGTATAAACTCATCATATATTGAAGATGGTTCTTTTCAATCAAATGCA
CTTATTTGTGATGACTAAGAAAATTCAATTTAAACTCAAGCTAGTGTATTTGACTTTGAT
GATAACAACAATAAAAACTTCCTCCTAAACCTAAATTACACCAACTCAAACCAAACAACT
TCCACTACAGGTACTCAAAATACTCAAATAAATTCATAAAACTCAACAAAAGTTTAAGAA
ATTATTCAGAAAGCTCCTGAGAAAGTACCTACTCCTATTTAAGAAAAGAATAACAAGAGA
TTGATTGGAAATAGCAATCAAATCAGAAGATCGAAAACCAAAAAGAATCATAAAAATAAT
TGA


>Contig17773.0.g43(protein)
MITPTKREDKEVTMSQQFSQLSPDMESILKNRRMRKILRKTQQKTEKESNCEFDEEHEEE
LYKNRCTVCLEDIHFKAQPNECVHIFCQSCIQAWTKFSNLCPLCKSEIKILNLFDQKGDF
QESIKIEKPQASEEQLQEWVQEFAESCYICCSGIDENLMLVCDECNFNVAHTYCLDLPEV
PEEDWYCSQCAEQRQTAEQMRVKKLKMKKQLQKQKKSNKKVKYTKSQQRNKSEDRINLGS
FDLTKHLKQNSELYGDDEEEDVTSFKFNTKMNLDQFSSQNKARFGFSKKIQYQDSQKCIT
SSIEEQSAGSYKHLKNIQNKQILNKQQRKQQIYSIDSSIDMSQPKRFKQTDYVLKRSDRS
SCQQSINSSYIEDGSFQSNALICDDQENSIQTQASVFDFDDNNNKNFLLNLNYTNSNQTT
STTGTQNTQINSQNSTKVQEIIQKAPEKVPTPIQEKNNKRLIGNSNQIRRSKTKKNHKNN