Identifiers and Description

Gene Model Identifier

Contig17250.0.g105

Standard Name

PHRF1d

Aliases

Contig17250_0_g105

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam13639 ) Ring finger domain
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam00628 ) PHD-finger
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam08274 ) PhnA Zinc-Ribbon
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001069105.998633383648922e-18hypothetical protein
SGDYPR031W0.0000020007268868677913NTO1 SGDID:S000006235, Chr XVI
from 631515-633761, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17250.0.g105(coding)
ATGGAAGAGGAATCTAAAAATTCCACAACTAGAACTCTCAGGAGAACTAGTAACAAGTTT
CATTTAATAGAACAGCAAAAGCAAGAGGAAGAATAGGATAAGTGCACGATTTGTCTTGAA
GTGGTCAACTAGAAAACGAAGCCCAAAGAGTGCTCACATCTTTTTTGTCTTGAGTGCATT
CAATCATGGTCAAAAGTCGAAAATAAATGTCCCTTGTGCAAAGTTCAATTCACTTATTTG
CATGTATATGGGAGCCAGAGCAATAGCGAGGGGACATAAATGGTATTCGCAAACTCTAAA
TAGAAAGAAAAGATTATAAAGAAGATACGGGTTAAGAAAAAGACTCAAGAGTATGATGGA
GGAACTGAACTTATCATGGAATACGCTGATGCTTGCTACTTATGTGGAGAAGGAGATGAC
GAGGCAGGGCTGTTAGTTTGTGATCATTGTGACTACAGAGTGTGTCATTTTGAATGCTTA
GGGTTAAGTTCAGTTCCTGAGAGCTAATGGTACTGCGAATACTGTGTAGAGGAAGATGAA
AGCTTGAGGCTATCAAATTTACAGCCTGTACTTATCACAACAACAACTACAAGAACTACT
ACGACCACTACAACTCGTAGAACACTAACTTCAAGATAGGCTGCAGCATACTTCAATACA
CTTGTTGACAGTTAATAAACTTAACCTGTGCTGAATAGAAGAAGAAGGAGAAGAAGGGTA
AGAAGAAATAGAAACTAAAATAATCCAAATGGTATAAGCAAGAAGAAAAAGAAGAGATTC
CGTAAAAAGTGGAGAAATGGCAACAAAAAGAAGAAAAATGCTAATTTCTTCCGAAGGAGA
CGCAATGACGATAGTGAGTTTGACTCTGATGAAGACTTAGAATAAGATAATAAAGTGAAC
TAAAAGATAAAGTAGCAAACAAATAATAGGTGCATTCAAAGTTCTGATGAAAGTGGTAAC
GAGGCAAACGATGAAGAAAGTAATTAAAGTGATGAGGAGGGAAACAGTGAGAATGAAAGT
GAGTAGGACACTTATGAATCTGATAATGATTGTATTAACAAAAGCACCAGGGTAAATACT
AGGTCAAAGAGCATCAGAAAAATCTTCAAATAGAAAAAGAAACCGTACTATAATACTAGA
TTTAAATAAAAATATGTATTTTCTTGA


>Contig17250.0.g105(protein)
MEEESKNSTTRTLRRTSNKFHLIEQQKQEEEQDKCTICLEVVNQKTKPKECSHLFCLECI
QSWSKVENKCPLCKVQFTYLHVYGSQSNSEGTQMVFANSKQKEKIIKKIRVKKKTQEYDG
GTELIMEYADACYLCGEGDDEAGLLVCDHCDYRVCHFECLGLSSVPESQWYCEYCVEEDE
SLRLSNLQPVLITTTTTRTTTTTTTRRTLTSRQAAAYFNTLVDSQQTQPVLNRRRRRRRV
RRNRNQNNPNGISKKKKKRFRKKWRNGNKKKKNANFFRRRRNDDSEFDSDEDLEQDNKVN
QKIKQQTNNRCIQSSDESGNEANDEESNQSDEEGNSENESEQDTYESDNDCINKSTRVNT
RSKSIRKIFKQKKKPYYNTRFKQKYVFS