Identifiers and Description

Gene Model Identifier

Contig1671.0.g18

Standard Name

PHRF1c

Aliases

Contig1671_0_g18

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001069101.9999391735788327e-19hypothetical protein
SGDYLR247C0.0000009995106777214876IRC20 SGDID:S000004237, Chr XI
I from 633354-628684, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1671.0.g18(coding)
ATGGTAGATGATGAAAAGTACTATGAAGGGAGATGCAGCATTTGTCTAGAGACAATTTAA
CAAAAAGCAAAACCCGAAGAATGCCAGCACATATATTGCCAATCTTGCATCCTATCATGG
ACAAGATTCTCAAATGTATGTCCACTTTGCAAAGTAGAGATTACTAAAATCCATTTTATT
AATGAAAAGGATGAAATGGTTGGAATGCATTTAATAAACAAACCACCTTCGTAGAATCCA
TACTCTGAAGAGCAACTACTTGAGGATTTGTTCAGAAATATGGCACCTCACTGCTATGTT
TGCAATAAAGATGATAATGAACGATTCTTACTGCTTTGTGATAGGTGTGATTACTAACTA
TGTCATACTTATTGCTGTGGAATGGGAGAATAAATACCAGATTAAGAATGGTTTTGTCAG
GGTTGTTAGGATAGTATAGAAGCTGAGGTCAGACTTAAGCAGAGATTGAAGCATTAAAAA
CCTAAAAATAATGGGAATTAAAAGAGTTTTATTTTGGAAGACTTGAGTTAAGAGGAGGAT
TTGATTGACAGTGAAGTATACGATGAGTTGGAGAATGAAAGTGAAGAGGCAGAAGATAAG
AGCAATATCACTCAATTATTGAAGCAAAACACCAATCTTTATAAAGAAAGTGATAATGAG
GATTCAGATAATGAGATTAATGAAATCATTTAAAATTTATCATCTACAGATGAGAATAAT
TCTCCAAAGCTTGAAACCCCACAGTCTAAAGAGAATCATCAACACATTATAAAATTTGAT
GACAAGAAGTTAAATCAATTATATCAAGAATTGAAATAGAAATCATAGAAAGATTCATTG
CCTGCTAAAGATAAGAAAATGAAAAGTACTAAGCCAAGAAAACCTAAGAATAAAGTCTAC
TCGGATAATGAGAGCATTGAAGATAAGCTATCTGTAGTTAAAGAGGATATTTGTACTGTG
CCTACTAGAATATCTAAACTAAGAACAATTCCTAAGTAAAAAGTGAGTAAATCAATAAAT
AACTCTGAAGAAGAATGTAACAATAATCATAACAAGCAATAATAGAAGAAAAAATAGAAA
TCAATTAAGTAAGAGAAACCGTAAAGTCAAAATACATGTCTCAAAGAAAATAGAAAAAGG
AAAAAATTAAACAGAAATTTTGTAGATAACGAAAATGATCAATATCAAGACAGATCTTTG
AAAAATAGCATAGCAAATAACTTCTCATAAATCTAAAATAACTTTTAAATTTCTGAATAG
AACCATCAATAAAAGTCAATGTTAAATCTAAATAGCATGTCAATGTTCAAGAGTGGATCT
TTGTTGAATTCAGAACTTCCATTTTTTAAGACTCAAGCATATGGATCATAAATTACAGTG
AACTTTATGCAAATTGAACAAAAATAGTTATTTGAATAGTATCAGTAATCTTAATAAAAG
TCTGTTTAAATCGATGAGGTAGCTGAAGAGCTTAAGAAGTAGTAATATGAAAAAATGAAG
CAAAGAATGGAATTAGAGTAAAGCAAAGGAAGTGAATAAATACTTAACAGGTGA


>Contig1671.0.g18(protein)
MVDDEKYYEGRCSICLETIQQKAKPEECQHIYCQSCILSWTRFSNVCPLCKVEITKIHFI
NEKDEMVGMHLINKPPSQNPYSEEQLLEDLFRNMAPHCYVCNKDDNERFLLLCDRCDYQL
CHTYCCGMGEQIPDQEWFCQGCQDSIEAEVRLKQRLKHQKPKNNGNQKSFILEDLSQEED
LIDSEVYDELENESEEAEDKSNITQLLKQNTNLYKESDNEDSDNEINEIIQNLSSTDENN
SPKLETPQSKENHQHIIKFDDKKLNQLYQELKQKSQKDSLPAKDKKMKSTKPRKPKNKVY
SDNESIEDKLSVVKEDICTVPTRISKLRTIPKQKVSKSINNSEEECNNNHNKQQQKKKQK
SIKQEKPQSQNTCLKENRKRKKLNRNFVDNENDQYQDRSLKNSIANNFSQIQNNFQISEQ
NHQQKSMLNLNSMSMFKSGSLLNSELPFFKTQAYGSQITVNFMQIEQKQLFEQYQQSQQK
SVQIDEVAEELKKQQYEKMKQRMELEQSKGSEQILNR