Identifiers and Description

Gene Model Identifier

Contig18265.0.g58

Standard Name

PHRF1b

Aliases

Contig18265_0_g58

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001069108.99902975825788e-19hypothetical protein
SGDYJR119C0.00000039992052383199455JHD2 SGDID:S000003880, Chr X f
rom 646490-644304, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18265.0.g58(coding)
ATGGAAAATTTAAGCCAAGAATCATCAAGCATCCCTGATTTCACTTCAGACGACTTAGAA
GAAGCATTAAGTGATAACAACAGTCAACAAAGTCATGCTCCCAACATCAATTACCCTAAA
AACAATCAAAATAGAAGTGATTAAAGACTGAAGGACATCACAGATAAAACTAATAACAAC
ATCAAATCGTCGGCTAATGAGGAGAGTGCTGAAATTTTGCTGCCGAGATCAAAGCGCAGA
TTATATTCAGATTTGGCTGAAGACTTAGAAACCACTAAAAATCAGGATGAAAACTTAATC
ATGTCAAGTAGAAGGTAGAGAAGAAGACTAAACTTAGAAGAATCTAAGAGCGAGGTAGAT
CTAGAAGACTTTGATTTGGATTAAATACGAAACAGGTAATCTCAAAACTCAATCTAAATT
GACTTGGACTAAGTAAGCTAATAATTAGACAACAAAAACACCAGTTAGCAACAACAAGCC
CCACGAGATCCTAGAAGAATCAATTCAAATACTTTTAACTATAACCCCCAATCAAGATAA
AATATTCAAAATTGTTCTCATTAAACCATCGGAGGTCACAATCATAGTCATAACTCAAAT
AATTAGGGATCTAGAGGCAGTAGAAAAAGTAGCAATCATTAGAGTGAAGAGAGAATCTAG
TAAGAGGAACAAAATTAGGATTTAGTTGGAGAAAATGACCCAAGATTTTCGTTGAGGAAG
AGAAGATTGAACAGATTACAAGAAAAAGTTCAAGATAATCGGAAATCCTTGGCTAAACTT
GAGCCACAACAATAGGAGAAGATGTGCACGATTTGTTAGTGTGAAATGGAACTTCAGGAC
CAAGCAACCATTGAATCCTGCATTCACGTGTTCTGCTTTGTGTGCATAAAAGAATGGGCA
ACTAAAGCCGAAAATACCTGTCCACTTTGCAAATAGAAATTCAATAAAATATCCTATACT
GATGAAAAAGGAGATCTCAAGATTTTACCGATAGAAAATAAACGCCAACGAATTGAGGAA
AATGAAGTTTATGTAATCGATGAGGACTCGGATGATGTTTGTTACGTGTGTGGCTTGGAG
GATAACCCCGAGCAAATGATCATATGCGATTTGTGCGATTATCATGTAGCACATACTTAC
TGCTGTGGCTTTGGCAATCGAATTCCAGAAGGAGATTGGCTGTGTGGTTATTGCACAGGA
TTAGTCAGTGACAGTGATGAGCCCGATAGCTCAGTGGGTGAGATCAGTGAAGAAGAACTG
GAATACTTAAGTGGAAACAGACAAGCACAAAACAATAACTAAAGAAACAGACTTCTCTAG
CTCCTCAACCTTGTGCCAGACCATGATGTTCACATTGGAGGTGTGTTTTCTAATATCTTT
GGAGGGCAAAGACAAACAAGAAATACCCGCAACAATAATCAGCGTTCAAACAGATCATCC
AGATATAACCTCAGAAACAGTAATAGCAATCAGCAAGTACCACAGCAACAATAAAACGCT
AATAGAAATAATAATGGAAGAAGAGCAGCAGCTCAGAGTAACAACAATTACAATAATCAA
AACTAACAGAGATAATAGTAAGTAACTGAGATGATACAGCCAAGAAATACCAATAGATAG
CAATAACAGTAAAATTAACAGCAATCTAACCCACCACCATAACAAAATAGTAGAAGAGTC
CTAAGAAGAGTTGTCTCCGAAGATTCATCTTCATCATCATCCTCTGAAGATTCTGGGAGA
GCTGCAGCAAATGGCAGAGGCCGTGGAGCTGTAGCTAATTAAAGACCTTAGAATTAAGCA
AGTACAGTATAAAATCCCGGGTAAGATGAAATGAATAGAATACTAAGAAATATGAATGAA
TTTTCCTATAATTAAAGATAGCAGTAGCAGTAGGCAACTTCAAGTAATAGACAGTAGCAA
CCTGCTGCGAATGCATCCATGAATAGCTCCAGTAGTTCATCAACCAGTTAAGTTGCAACA
AGGTCTAATCGAAGACTGACTCGCGCTCTCTCATAAAGTATGGAAATTCCTCAGAGACAA
GTAGTAAATCAGGAAGGCTCAGTCAGAACACCTGAAGAACTAAAAGCTTTCATACATTAA
TTCGCTAGTGGACTGTTGAATGTAATTCAAACTGGAAGTAACTCAGTGAATGACGTAAGT
ATTCAATTGACTGTGGACAGAAGAGAGCAATCAGCACTGGAGCAAGCAACAGCAGAAGCC
AACAACAGGAATGCATTAAGTCAATCATAACAATCTAATAATAATAACACTAATGTCAGG
AGAGGCAGAAGCAACAACAGACAAAACACCAATGCGAATAACGCTAATCAAAGAATTCAA
TCGTAAGCCCCACCAGCAACTCAGAGAACTTTGCGTGGAGGCAGCCGAAGGTAACAAAAT
CGACCCTATTTTGGTGAATTCAGTGATGATGAGGAATCTGAGGAAAATTTGATAAACATC
ACTACAGCACGATAAGCTAATGTAGTTGGCCCAAGGACTATCATAAGCAGCAGTACGTCG
AACATTAGTGTGCAAATTAACTCAAACCATTTAACCATAAATGTTAACGCAGCCAGAAGT
AACAATGTAGTGGAAGAAACCAGTGATAATGATAGTGATGATAGCGACGATGACGACGAT
GATAGCGACGATGAAGATGACAGTGACGCTGATAGTGATAATGAAGAAGAGAGCAGCAGT
CAAAATGATTCATCATCCTAATCAGATGTTAGCCCAAGTGTTGATTAAAGTTCTTATCCA
TCTTCCTAATCAAGCAGTGCCAGTCAGGCACTCGCAAGGAGCTTGGGTTCCTTCAACTAA
ATCACTGGCTTTGGATTGGCAAATAATAAGAACAGAAGGAGATGA


>Contig18265.0.g58(protein)
MENLSQESSSIPDFTSDDLEEALSDNNSQQSHAPNINYPKNNQNRSDQRLKDITDKTNNN
IKSSANEESAEILLPRSKRRLYSDLAEDLETTKNQDENLIMSSRRQRRRLNLEESKSEVD
LEDFDLDQIRNRQSQNSIQIDLDQVSQQLDNKNTSQQQQAPRDPRRINSNTFNYNPQSRQ
NIQNCSHQTIGGHNHSHNSNNQGSRGSRKSSNHQSEERIQQEEQNQDLVGENDPRFSLRK
RRLNRLQEKVQDNRKSLAKLEPQQQEKMCTICQCEMELQDQATIESCIHVFCFVCIKEWA
TKAENTCPLCKQKFNKISYTDEKGDLKILPIENKRQRIEENEVYVIDEDSDDVCYVCGLE
DNPEQMIICDLCDYHVAHTYCCGFGNRIPEGDWLCGYCTGLVSDSDEPDSSVGEISEEEL
EYLSGNRQAQNNNQRNRLLQLLNLVPDHDVHIGGVFSNIFGGQRQTRNTRNNNQRSNRSS
RYNLRNSNSNQQVPQQQQNANRNNNGRRAAAQSNNNYNNQNQQRQQQVTEMIQPRNTNRQ
QQQQNQQQSNPPPQQNSRRVLRRVVSEDSSSSSSSEDSGRAAANGRGRGAVANQRPQNQA
STVQNPGQDEMNRILRNMNEFSYNQRQQQQQATSSNRQQQPAANASMNSSSSSSTSQVAT
RSNRRLTRALSQSMEIPQRQVVNQEGSVRTPEELKAFIHQFASGLLNVIQTGSNSVNDVS
IQLTVDRREQSALEQATAEANNRNALSQSQQSNNNNTNVRRGRSNNRQNTNANNANQRIQ
SQAPPATQRTLRGGSRRQQNRPYFGEFSDDEESEENLINITTARQANVVGPRTIISSSTS
NISVQINSNHLTINVNAARSNNVVEETSDNDSDDSDDDDDDSDDEDDSDADSDNEEESSS
QNDSSSQSDVSPSVDQSSYPSSQSSSASQALARSLGSFNQITGFGLANNKNRRR