Identifiers and Description

Gene Model Identifier

Contig21467.0.g92

Standard Name

PHRF1a

Aliases

Contig21467_0_g92

Description

Zinc finger, C3HC4 type (RING finger)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR247C0.00000009004106436083642IRC20 SGDID:S000004237, Chr XI
I from 633354-628684, Gen...
T. thermophilaTTHERM_008581100.00000019998969434520019zinc finger protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21467.0.g92(coding)
ATGGAGAATTAGTCTAATATTGAGCCAAAATAAGAGAAGTAAAACAGTGAGGTTCAATCT
AAAAATTCAAAGGAAAATTTAGCAACTCAACTTGACTCAAACTAATTAGATTAAAGTTAA
GAAAATTCAAATATTGAAGAGCACAAAGAGATTAATCAAAATCTTGTTTATTCTTAAAGT
CATAACAAGTAAAAAAGAACATTTGATGAAATATCTCGTGATGAAAAGTAGAAGTTTATA
CCCCTACCTGTAGATTCAAGTAAAACAGACAACAGAGTGTTCAAGAACTATGAAAATCCC
TTTACCAACCCCAACCCCTAACCCCCTCTGAAACAATCAATAATCAAGGATTACAAGCAA
CAAAAGCCTCCTCAACCAAAGTTAATTTGCAACATTTGCATTGAAGAGCTCACTGACATA
AAAGCAGTGATCGATTGCAACCACTACTACTGCTTGGAATGCATTAAACATTGGGCTGAG
AATGAAAATACCTGTCCGCTTTGCAAAAAGGAGTTCATGTAGATTCGAGTCAAGAAAATT
GTTAACAATTCTAAACTCTCAAAGAGAAAGCCTAATATGCTCAGTGATAGTCTTGTGAAT
AGAGAATAAAAGTTTTCTCCAACTAAGTTTGAAAAATTGACAATCAATCAATTTCTGGAT
ATGCAAAGTACAGAGAAGAAGCAAGATTAACTAGATTCAACAAAAGATTTGGGCATTCTT
AACTCAAGTAGTATAACAGATAAAAGCAAACTTTACAAAGTAAGAACTTTGAAAAATAGA
AATCGTGAAAATAATCAAGGAAGTCTGAATGTTTCAAGAAATAACACTTTGTAAGTTTAG
AGTGATAAAAGTAAAGGCAAATTACAAGAACCGATTAGTGGCAACGTTGATGATTCTGTG
AGCTATGCACATGCTTAGAGTTTTATTACTGAAAATGATTTATCTGAGGAAGTTAATGTG
ATTGAGGTTGAACCCAAGAAACAAAGAGTCAATGATAACTACTTGGAGCTTAACAATGAG
TAGTTAAGGTAGATTGCTTTGGAGTATGACGATGAAGACTATTACGATGATGAGGATGGA
GAGTATGACAGTGAAGAAAATTCATAAATAGCTTAACATCAGCCTGCTTAGTAAATACTT
TTGTCAAGAGCAGATCAGAACAACCAAATCTAAGATCTCATAGACGGTTTGCCAGCTGAC
TTATTTGACTCCTTTGCTTTGAATTTGATCTCGTACTTTTGCATGACAACTTCAAATGCA
AGGTTAGAGTCTTGGAATGATGTTTTAATCATACCAGAGTCCATGAAATTAATGCTGGTT
GACATTCACAGAGATAGGTTAAGCAGACTGCCAGATCTTTACAGAAGAGCAATTATCAAG
TTTTGCTAGTTAAACCCTGAAACCTTTGGTGTTCAATTTCCTTTTATAAGTCCTGAACTG
GTCTTAGAAGCAGGAGATCCAGAACCACTCTATGTGCACATCAGTGATTTGAGGTTGCAA
CAGAGATTGTATTAAGAATTGGGAGGTAGAAATTTGGATTTCTTGAGAGGTTTCTAGCTT
GTCCTGGATCGCTAAAGAGAAGATGAAGGAATAGATGTAAACCCTAGAATAAATTTGATA
AACTAGCTCATTGCAAATGCTAACAACAACGCCAATGTGGATGAATCTGCTTCATTCAAT
TATGATAACGTTGGGCTAGACGAAGAGTATTCAGACAGCCAGGATGCTGCTAGAAGAGGA
AGTCAGCCTGGGAGAAATCGTGGAAACGTGGTTCCTAAAGAGGATAGTGCATCTTATGAG
TATGCTGATCCCTCAAGCAACAGCTACCAAAGTGAGATATATAGTATTCATGAAAGCGAC
TTTGATGAAGGAATGTGA


>Contig21467.0.g92(protein)
MENQSNIEPKQEKQNSEVQSKNSKENLATQLDSNQLDQSQENSNIEEHKEINQNLVYSQS
HNKQKRTFDEISRDEKQKFIPLPVDSSKTDNRVFKNYENPFTNPNPQPPLKQSIIKDYKQ
QKPPQPKLICNICIEELTDIKAVIDCNHYYCLECIKHWAENENTCPLCKKEFMQIRVKKI
VNNSKLSKRKPNMLSDSLVNREQKFSPTKFEKLTINQFLDMQSTEKKQDQLDSTKDLGIL
NSSSITDKSKLYKVRTLKNRNRENNQGSLNVSRNNTLQVQSDKSKGKLQEPISGNVDDSV
SYAHAQSFITENDLSEEVNVIEVEPKKQRVNDNYLELNNEQLRQIALEYDDEDYYDDEDG
EYDSEENSQIAQHQPAQQILLSRADQNNQIQDLIDGLPADLFDSFALNLISYFCMTTSNA
RLESWNDVLIIPESMKLMLVDIHRDRLSRLPDLYRRAIIKFCQLNPETFGVQFPFISPEL
VLEAGDPEPLYVHISDLRLQQRLYQELGGRNLDFLRGFQLVLDRQREDEGIDVNPRINLI
NQLIANANNNANVDESASFNYDNVGLDEEYSDSQDAARRGSQPGRNRGNVVPKEDSASYE
YADPSSNSYQSEIYSIHESDFDEGM