Identifiers and Description

Gene Model Identifier

Contig10619.0.g42

Standard Name

PHF5

Aliases

Contig10619_0_g42

Description

PHF5-like protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000390203.999627495270728e-67PHD finger-like protein
SGDYPR094W1.0000633497921574e-36RDS3 SGDID:S000006298, Chr XVI
from 720637-720960, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10619.0.g42(coding)
ATGGCGAAACATCATCCCGACTTAATTTTCTGCAGAAAACAGCCAGGTGTGGCAATAGGC
AGGTTATGCGAGAAATGTGATGGAAAGTGCGTGATATGCGATTCTTATGTGCGTCCATGC
GCATTAGTGAAGATATGTGATGAATGTAATTTCGGTAGTTTTTAAGGGAGATGTACGATA
TGCGGTGGGCCAGGCATTAGTGATGCTTATTACTGCAAGGAATGCACGTAGATGGAGAAA
GACAGGGATGGATGCCCTAAGATTGTAAATTTAGGCAGTGCAAAGACTGATTTGTGGTAT
GAGAGAAAGAAGTATGGGTTTAAGAAGAGATGA


>Contig10619.0.g42(protein)
MAKHHPDLIFCRKQPGVAIGRLCEKCDGKCVICDSYVRPCALVKICDECNFGSFQGRCTI
CGGPGISDAYYCKECTQMEKDRDGCPKIVNLGSAKTDLWYERKKYGFKKR