Identifiers and Description

Gene Model Identifier

Contig6408.0.g98

Standard Name

PHD9

Aliases

Contig6408_0_g98

Description

Putative zinc finger in N-recognin (UBR box)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004447000.00006000996057121373PHD-finger family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6408.0.g98(coding)
ATGGAAAAATTTGAAAATAACAACGATCTCTAGAAAAACATTGCACAACCTGACTCTGAA
TTTCAAAAACCAGAGACCCACCTATCTCCCAACTCAGAAATGCATAAGCTATAAAATTAA
GCTGAAATCTCAAATCAAGGCAGCACTTAAGATGGATCTAGTTCTCAGAACATAATCGAA
AGCGGCAGCAATTAATAATAGTAAATTTAAAAAAATGAGATTCAGCAATAATTGCATCAA
CAAATTGAGGAAGATATATCGAATTCTCCATCTAAAATTGAAAATGCAAATAAATTTTCT
AAAGAGAAGAAAGAATTCTTGGATCCAGAGAGTCCCACAAAGTTGTTGGGGAGTGCTACT
AAGAGCCAAGCAGTGGTTGAAGAGAGTGACGAGGAAGATGTTAAGACATTATCGCAGCTC
TACATAGATGCTGAAAGAGAGGAAAAACTGCACAATCAGCTTAGTAAAAATGAGCTCACA
AAAAAGTGTAGATATACTGATGGCTACATCTATTAGTAAGTCTATAGCTGCATCACATGC
TACATGGAATAAATTAAAAATTTACCAGGTGCTGAAGAAGTGGATGCTGAAAAGATTATG
AAACAGGGTTTCTGTGCTTTTCCTGAGTTAATGAAGGAACTGAAGCCTCATGGCATATGT
CTAGGATGTATGTTACACTGCCACGAAAATCATGATGTAGTTGAACTTTACGCTAAACTT
GATTTCAGATGTGATTGTGGTAATGGACGCATGCCTTTCTCATGTTCCCTATATGAAAAT
AAGGAAGACTACGAAAACGATCAGAATAGATACAATCAGAACTTCTTTGATATCTACTGT
TACTGCAAGCAGCCTCACCAAACTGAGTTGATCGACTAATTTATGATATAGTGCTTTGAA
TGCGAGGATTGGTATCATAATCATCATCTAAATCCTAAGTTAAGTGATTAGCCTGATGAA
AAGTTCATTTTGATTTGTAAGAACTGTCAAATTTAAAAGTATGGAATTAAGCTCCTTTAA
TACAAAGATTTCTTTCATGAAACAAGCCAAGACTAAATTTAGCATAAGAATAATGAAACA
CCAAGTAAAAGACAAAAGCTCTCAAATGCTGCTGAAAAAGTAGTTTAATTTTAAGGAAGA
TTTAACTGTAAAGAAAATGCACCTCAAGTTAACCCAGATTTTCAGCCTTTCGACATTATA
ATTGACGATGCTTTCATTGAGAGCTCATGTTAATGTGATGAATGCAAGCCAATCTTTGAT
AGACTTTAAAGGCACCTTAAGGCCGTAGATAATTTGAACGAAGAAGACTTAAAGCTTCAA
AAGAACTTGGAGGGAGAGCTAAACGAGGATGAGGAAGAGACTAAAGATCAGTCAAGCAAT
CGTGCTGAAGCAATATAATCCAATTTAACTTCAGAAGACTATTTAGCCAACATGATGAAG
AAAGTAATGTAAGGCTCTAATTAACCAATGTCACATTAAGGCCAGATATTCTTTGCAGAG
GAGTACAATAAGTTTAAGGAATACTTTGTCAACTTTCTCAAACAATTTGAGAATAAAACT
GGAAAAATCACAACTGCTGATATTCAAAAATTCTTAGAGGGTTTAGAAAATCTTAAGAGT
CAAAGATAAAACCAAAATAAGTTTCAGTGA


>Contig6408.0.g98(protein)
MEKFENNNDLQKNIAQPDSEFQKPETHLSPNSEMHKLQNQAEISNQGSTQDGSSSQNIIE
SGSNQQQQIQKNEIQQQLHQQIEEDISNSPSKIENANKFSKEKKEFLDPESPTKLLGSAT
KSQAVVEESDEEDVKTLSQLYIDAEREEKLHNQLSKNELTKKCRYTDGYIYQQVYSCITC
YMEQIKNLPGAEEVDAEKIMKQGFCAFPELMKELKPHGICLGCMLHCHENHDVVELYAKL
DFRCDCGNGRMPFSCSLYENKEDYENDQNRYNQNFFDIYCYCKQPHQTELIDQFMIQCFE
CEDWYHNHHLNPKLSDQPDEKFILICKNCQIQKYGIKLLQYKDFFHETSQDQIQHKNNET
PSKRQKLSNAAEKVVQFQGRFNCKENAPQVNPDFQPFDIIIDDAFIESSCQCDECKPIFD
RLQRHLKAVDNLNEEDLKLQKNLEGELNEDEEETKDQSSNRAEAIQSNLTSEDYLANMMK
KVMQGSNQPMSHQGQIFFAEEYNKFKEYFVNFLKQFENKTGKITTADIQKFLEGLENLKS
QRQNQNKFQ