Identifiers and Description

Gene Model Identifier

Contig13669.0.g41

Standard Name

PHD8

Aliases

Contig13669_0_g41

Description

PHD-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000710600.0000009995106777214876hypothetical protein
SGDYPR031W0.0007999190683310628NTO1 SGDID:S000006235, Chr XVI
from 631515-633761, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13669.0.g41(coding)
ATGCAATCTTAGAGATCAAATAAGCAAAAAGATAGCAAATCAAGTCAATCTCAGTCAACT
CTTACTTAGCGTCAGTAATCATCCCAGAGACAAAAGTCTGAGGTTAAAACATCTAAGGAC
AGAGGAGACGTTTAAATGAAGGAAGAAGATAGTGTGCGCCCTCAGAGTAGACACAGCTAA
AACACTAGAAATCAGAAAAGTAAAGAGAGCGCACTCAGTCAAGGAAGCAGAAAGCAAAGT
CAGGGAAAAGTAAAGATGGAGCAACCTCAACCAAAATAGAAGACCCAAGTGAGTGCTAAA
TCTATTGATACCAGACCTAAGAGGGGAGAAATTGCGAAAGAGTCAATCAAAGAAAAAGGA
AAGAAACCAGTCCAGAAGAAAAGATCACAGAGTGAAGATGAAGAAATGAAAGAGGACTCA
GATCAAATTTCAAGTGACCATTCTGGATCATCGTCTGATAATGAGTCAAATTCTTCATCA
TCATCATCTAACGAAGAAGAGAAAAAAGAAAGTAGATTATCTCAGAAATCTAAGGCAAGG
CAATCTCACGGACATTCACAACAGGTTATCACAAAGTAACTAAACGAAAGCAAAGGCTCA
AAGGTAAAGAAGAGCTTGAGGTACGTTGATAGAATAAAGAAAGAAGTTGATATTGATAGC
AAGCAAAAGATCAAATTTCAGGGCTACACAGAGAAAGACAGTTCAAACTAAATGTGTCAT
GCATGCTTCCAGTCTTAGGAGTTCCCAATTACTAAAGATGAATAATATGATAGTCAGGAT
TACTCAGAATTAACTTAAGAACAAGAAGATGCCAAACTTCTATATGAAATTGTTTATTGT
CTTGAGTGCTCTATAGCAGTTCATTATGCATGCCTAGGAGAAAAGCATCAACTTTATGAA
ATATCAAGAGGTAATCATGAGTACTTAATTTTCAAGTGTGAAAAATGTGAATTGAAGTAA
TAAGGCTTACATACAGATTTCAACTGTTTTGTCTGTAAGAAAGATGAAGGGTACTTAAAG
CCAGTGAAAATTAAGTAGAAGGGAGACAAAGAAGAGGATGAACTGATCTTTGTTCATTAA
ATTTGCGCAGTCAGCAATAACACTGTTTTTTAGTGCAAAGATCCATTTACTATGACTTTT
GAAATGGACACAGAATAAAAAGAATTCCTGTCTTAGCAATGCCTCAATAAAGGTCATAAA
ATTGAATGTGAACTATGTCACTCTTCAAGCGGTAAAATGAAAGAATGCAATATCTCTGGA
TGCAACTAATATGCTCATGCTTACTGCGTTATGAATTTAATGAAGGAGTATTGTTATGGA
ACTAAGGCAGAGGAGGATGACATAGAAAATAAGCATCCTCAAAGATGGATGTTTCAGATA
ATTTATTCTAGTGAGAATGAAGAAGACGTGAATATGAACTTTATATGCAATACGCACATG
ATTTCAGAAACAACTTATTGCTATTGTGAACAAACTCCATAATAAACTCAACTTTTTATG
TGTGATTACTGCTACATATGGTATCATGCTACTTGTTTCGATGGAGATATCCCTTAAAAT
TTCAAATGTCCTAAATGCACAAAATGGTTAGAGAAAATTTAGGAGCCAATATTGAACATC
CTTCTAAATAGAAAGCCAATCGAAAGTTACTTGAATGAAGACAAAACTGAATGGTCTTTT
GAGTATTTGTTATTTAACGAAAAAGAGACTTAATTTGTTGAATCTAGAATCTTTGAATAG
ACTATTTTCACAAAGTTGTGGCATGTATTAGCTGAATTCATGATCTCACATGTTGTTCAC
TAAAACTTAATACAAAATCATCTAAAGCTCGAAAGACTTCTCATTTTAAGCTCTTAAGAT
TTATAGGATAAGCTTAAGCAAAAGTAACTAGAAGGGAAGGCTAAAATTGAACAAGCTGTA
AATAGATTTAAAGAATAAAATTAGCTCCAACTTCTTGATGAAATAGATAGCTAGTTAAAA
ATGATTCCTGAAAATGTCTAGAAGAATAAGTTGATTGCAGCAAAGCATTTAGAAACTTAT
AAGAGCCTTTTAAGTGAAACTAAGTTATTGAACGATGATATGTTATAGTTTAAGCATGCC
CAAATAAAACACAAACTGCTTCAAGATGCTTAGGCTTACTTAACTCATACAAAAAATAAG
CCAACAGAAACTCAAGTTAGTGAGACTTTGGATCAAATGAGGTAATATGACATGGAAGAG
TATCTAACTTACTAATTGTTGCAAGAAGTTTATAATGATTATGAATAATGGGAACAAGAA
TCATTAGCTAAATTTTAAGGAGAAATGTTATCAGAAAATGCAATCCAGTAACAGTTAGAC
AGTTTCAAGAGAAATAAAGGAGGAAAAGTTTTATAAAACACTAAATACAAGTATCTCAAA
AGTTTAATAGATAGAAAAAGTACTGTTGAAGAAGGGTTGAAGTTATTAAGCAATGGTAAA
AACTTAAAAGTTAATATTTCTGATCACATCCAAGCATTGAAGGGTTTTATTTCTCGTTAA
GAGCATGATGAAAAAGAATTTTACAAACTAGAGAAAGCTAACAAAACTCCCGTTAAGCAT
GTGTTAAATTAACTTGTTGTAGCTCTAGCATACCCTTTAAAGACTAAAAATATTGAAAAT
ATACTTGAAAAATGGTATCAAAGCGCACTTTGGCACTCATCAGCAAAGGGATTCGTAAAA
GACAAGAAACTGAGGTCTTAAGATTCCCAGATGGACATAGACGAAGGAGATGGATCAGAC
TTAAAAGAAAAAGAATGTTGGACTATAGAAGAAGGTCAGCAACTTATGAGGGAAGCCCAT
TAAAAAAAGATTTACTATGATTAAATACTCTACAACAATCTAGAGGAAAAGGTAAGAGTA
GTCTCTCTGCTAAAGGAATCCTTGAAAACAGCATTAAGTGATAAAAATGACACCAAGGGT
ATGAAAGATTACATTAAACTGTTAAAACATCACGAAAATATTGATTTTAAAATGGAAATT
GAAAAATGTGAGTAAAAGCTAAAAATTATGTAAGAAGCAAGTGGAGTTATAAATAATGAT
GGAAAATAAAAATACAATATCGAAAAGCTAGAAGCACTAAATAAATGA


>Contig13669.0.g41(protein)
MQSQRSNKQKDSKSSQSQSTLTQRQQSSQRQKSEVKTSKDRGDVQMKEEDSVRPQSRHSQ
NTRNQKSKESALSQGSRKQSQGKVKMEQPQPKQKTQVSAKSIDTRPKRGEIAKESIKEKG
KKPVQKKRSQSEDEEMKEDSDQISSDHSGSSSDNESNSSSSSSNEEEKKESRLSQKSKAR
QSHGHSQQVITKQLNESKGSKVKKSLRYVDRIKKEVDIDSKQKIKFQGYTEKDSSNQMCH
ACFQSQEFPITKDEQYDSQDYSELTQEQEDAKLLYEIVYCLECSIAVHYACLGEKHQLYE
ISRGNHEYLIFKCEKCELKQQGLHTDFNCFVCKKDEGYLKPVKIKQKGDKEEDELIFVHQ
ICAVSNNTVFQCKDPFTMTFEMDTEQKEFLSQQCLNKGHKIECELCHSSSGKMKECNISG
CNQYAHAYCVMNLMKEYCYGTKAEEDDIENKHPQRWMFQIIYSSENEEDVNMNFICNTHM
ISETTYCYCEQTPQQTQLFMCDYCYIWYHATCFDGDIPQNFKCPKCTKWLEKIQEPILNI
LLNRKPIESYLNEDKTEWSFEYLLFNEKETQFVESRIFEQTIFTKLWHVLAEFMISHVVH
QNLIQNHLKLERLLILSSQDLQDKLKQKQLEGKAKIEQAVNRFKEQNQLQLLDEIDSQLK
MIPENVQKNKLIAAKHLETYKSLLSETKLLNDDMLQFKHAQIKHKLLQDAQAYLTHTKNK
PTETQVSETLDQMRQYDMEEYLTYQLLQEVYNDYEQWEQESLAKFQGEMLSENAIQQQLD
SFKRNKGGKVLQNTKYKYLKSLIDRKSTVEEGLKLLSNGKNLKVNISDHIQALKGFISRQ
EHDEKEFYKLEKANKTPVKHVLNQLVVALAYPLKTKNIENILEKWYQSALWHSSAKGFVK
DKKLRSQDSQMDIDEGDGSDLKEKECWTIEEGQQLMREAHQKKIYYDQILYNNLEEKVRV
VSLLKESLKTALSDKNDTKGMKDYIKLLKHHENIDFKMEIEKCEQKLKIMQEASGVINND
GKQKYNIEKLEALNK