Identifiers and Description

Gene Model Identifier

Contig18939.0.g108

Standard Name

PHD6

Aliases

Contig18939_0_g108

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13639 ) Ring finger domain
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam02183 ) Homeobox associated leucine zipper
  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam00628 ) PHD-finger

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004882000.000000000000001999258566166494erythrocyte binding protein
SGDYDR265W0.000009002574193719714PEX10 SGDID:S000002673, Chr IV
from 998864-999877, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18939.0.g108(coding)
ATGATAAGTTCATCTTTTTACCAAGTACCCCAGTGTGCTATATGTCTGCTTGATCTCACT
CAGAATTTATGTGTAACTAAGTGTGGCCATGTTTTCCATCAAATTTGCATCCAATAAGCA
GTGGAGAGCAGAAGTCAGTGTCCATTATGCAGGAAAGTTCAAACTCATGAAAACATACTT
TCAATCAAGTTTGGCATAAATGTCTGTGAGAGTTAAGAAGTGAAGGAGCTATTTGGTCAG
ATGACTGATGACGACAAAAAATAGATACTGGTTTGGCAGAGAAAATTGATTGAAACCACT
GAAGAAAAGTCAAAACTTACAGCTTAAGTAGCTGGTCTCTCTCACCAAAAGATAGATCTC
GAGAAAGAACTAGAAACTTACAAGATAGACAACAAGAACTAGAAAGAGGAGCTGAAAAGG
CAGAGAAACATCATCAGTGCCAATGAAACAAAGATCATTATGAAGGACTATTACGTAGAT
GAGTTGAAAAAAGAGAGAAGTGCTTTGCAAAAAGAGAAGGAAAATCTGCTCAAAGAAATC
TAAGAGATGCGCCTGACATCAGAGATATTTGACTAAATCGAGAAATCACACTCTAAAACA
AGCGTAATTCAGCATATTAAAACTAAGAACGACATGATTGAAGAGGAGAAAGTGAGATTG
CTCTACTAACACGCCATGATTCTCATCAGCAGTGAGGAGTAACTCAAGGAAAACATCGGG
AAACTGAAGAAGGAAATGATTGGCAAGAATCAATCATATGACTTGCTCAAGTTAGAAGCT
GATGACTACAAGAGAAGCTACGATAAACTCAAGAAAAAGTACTAGGAAACTGTTAAGAAT
GGGTAAATAGCCAAGAGAAATGAGAATGATGTCACTACCAGTTCTGATGCTAGCAACAAG
CCATAGCTTTATGATATCAACAAGATGTTGAAGCAGTAAAAACCGTAAGGTACCAGTTTT
GCTTAGCAATAAATTGGAAAATCTAGAGTTGAAGCTGGTGTAGTTACTACTAGCGAGTCT
TTATAGTACAACACAAAGCGTCGCAAATTCAATGAAATCAGCAATACTGCAGCAACTTTT
AACAATAAAGATTCTGATTTGTTTGTTTGCTCTCAAGATGATGATGCTTCTCAAAGTGGC
CAAAATTCAGTTAGTAGTTTAACTATTATCAACACTGACAGCCAACCATCAATAAAAAAT
ATCAACAAATTTGATGGTATGATAAGCAGCTAGATTGTTTAAACTTAAAAGCAACAATTA
ATTGATGATAAAAGTGACGTAGAACTGCTGAGTTTATAGAATGAATAGCCCAAATTTAAG
AAACCTAACTAACTCACTAATGGTTTCAAGTCTGGAATCTTCTAATCATTTAAAGATGGG
ATAAATGCTGAAAAATTCAAGAAATAGTTCACCTAGTAGAGATTTAATGATAGATAAAAT
AAAACTCAAAATGGCGTTCAACTTGGAATGTCAGGTTTCATTAACAAATGA


>Contig18939.0.g108(protein)
MISSSFYQVPQCAICLLDLTQNLCVTKCGHVFHQICIQQAVESRSQCPLCRKVQTHENIL
SIKFGINVCESQEVKELFGQMTDDDKKQILVWQRKLIETTEEKSKLTAQVAGLSHQKIDL
EKELETYKIDNKNQKEELKRQRNIISANETKIIMKDYYVDELKKERSALQKEKENLLKEI
QEMRLTSEIFDQIEKSHSKTSVIQHIKTKNDMIEEEKVRLLYQHAMILISSEEQLKENIG
KLKKEMIGKNQSYDLLKLEADDYKRSYDKLKKKYQETVKNGQIAKRNENDVTTSSDASNK
PQLYDINKMLKQQKPQGTSFAQQQIGKSRVEAGVVTTSESLQYNTKRRKFNEISNTAATF
NNKDSDLFVCSQDDDASQSGQNSVSSLTIINTDSQPSIKNINKFDGMISSQIVQTQKQQL
IDDKSDVELLSLQNEQPKFKKPNQLTNGFKSGIFQSFKDGINAEKFKKQFTQQRFNDRQN
KTQNGVQLGMSGFINK