Identifiers and Description

Gene Model Identifier

Contig361.1.g30

Standard Name

PHD5

Aliases

Contig361_1_g30

Description

PHD-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig361.1.g30(coding)
ATGGTCAAGAGAAACAAATCGAAAGATTCTCAGTAAATGCTGATTGTTACCAAAAAAGCC
AAAGAAAAATCTAACATAGAAGATGAAGAGGAAGTTATGGAGGATGTAGAAGAAGAAAAG
CAAATTATTAATAATAACGAGGAAGAGTCTGATGTTAAAATTAAGAAACACAAATCAAAA
ACTAAAGTACAAAAAGATAGGGATGATCGCACAGACCAGTCTAATAGTCAGTAAAATACA
AATGTGTGCGATGCTGACTTAGATGTCATTATGACAAATGAGTCGCACTCTGAGATGCAG
AGGCCAGTAGGAAAGCTTGATAAAATGTTCAAAAATACCAGATCATCGCCTAATCGAATA
AAAGTCACTAATAAAATGAAAGATACAACCAAAATATCCAGTGCTGCCACTAGTCCCAGG
AAAAAGTTAGGAAGCCAACATTAAACAAAACTATTTTAAGCCAAAGTAAAGATTTGTGAA
GTGTGCTTTTAAATATCAAATTGTCCATTGAAAGATAGCGGCTATGATATGATTGAGTGC
AAAGGGTGACTTATGAGCTAAATTATCGATGAAGAAAACTAATATGTGCATGTTATTTGT
GGATTAATATCTGACTTATACGAAATTAATGACTTTGGTAAAATGACATTTAAGAAGTCA
CCATGTTTTGATTAAATCCAAGGATTCAGCAAAAGCAAATTAGGATGGGAAATCGATTTC
AAACTCTAAGATTACTCATAGTAATAGAATTATAAGAATACACTGGACAATTATTAGTTC
ATTAAGAATACAGAATTCTTTGATGATGATCTATCATTGAAAACACCTGCTAAGCATATT
TCAGACTAATCTAATTCAACAGGTGATGTAAAATTAAAGAGGAAAGTTAAAAGTGGGACT
AATCAATCTAAAATGAATCCAGATGGAAGCTTGAAGTTAAATAAAATGCATTCAAAACTC
AACTTACCTTTGAGAGGTGGTAAAGTCAGTGTAGTTTGTGATTCGCATAGAAGTGAACAG
AAGTCTTGTGTTTGTAATTTTCTATAAAGTGATCCAAGCACTCATAAAAATAGTGATTGG
ATAATGTGCGATTACTGTGAGATGTGGTTTCATAATAAATGTATTGGCTTGGGACCAAAA
GAACTGAAAGAGATCGATAAGTACGTATGTTCAAAGTGCGAGTCTTGGAGCAATTAAAGA
ATGATGATTATTGCACCAGCACTTGTGGGAAGTTAGTCAAAATTTAACCTACTGTTCCCA
CAAGATAAAGATTCTTTGAACAAGTACTGGGAATGGAAAACATGGGGTAATGAAATATTT
CCAAAGGAAAGGTACAAATTAAAGCTAATTGATATGATATTTATATGCTAAATTTGGTCT
GAGCAAGCAAAGTAACTTATTAGTCATTATGTCACTTCAGAATTATCAAAGTAGTAACTA
TTAAGAGCTTAGTACATACCTCTAAATACATATTCATTAATTCTTGGCATTAATGAGAAA
ATCGAGAAAGTAATCGAATATGAAAAGTAAAACTCTGAGATATTTGAAGACTATTCATAT
CAAGACATAAAACCTGTTTTAATTGATGGTATGAAATAAGAGCCAAATATTGAAGAAAAC
CAAAAATTAGCTTAAAAATTTAGAGAGGTAATTGACTATGAAGAACAGTAATTAAAGCTT
AAATCTTAGCGCTGTGAGGAGCTTGAAGAATTTTATGAATTAATTGAAACAAAAATCATG
CTATCCGATATTTTATCAGATAAGAGCAAGAAAATATCTCTAGAAGACATTGATAAGTTT
AAATAAGTCTATGCTAGAGCTGATGGTTATAAATGCGAAATGAAAAGTCAGCTTGAAAAA
TTAGTTAAAGAGGGAAAAGAGGCAATGACTACTTTTAATCCTCTGATAAAGAAAACTGAA
GCAGTAATTTCAAGTTCGATATAGGATATAGTAAAAACTCTCTCAGGTAAGAAATCAAAA
GACTGGATTTAATAAAATGTATTTGATAAATTTAAAGACTCCAAGATCGATTATACTAAG
CAGTTTCAGAAAATAAACTTAGAGCTTAATAACACAGATAAAATAGCCTCAGATTTGGAA
AATGCTCAAATTCTATAAGATTGGATAAAAGCAATATAATAATCTGAGAAACTGATATTT
ACCAATTAAACAATGACATAATAAATTGAGTTTTACAATAAAAACAAGTCATGGATTAAT
CAGTATATTTAGCTCATAGATATCAAGTTAAAGAATCAAAACAAAGTATCAAACTTAATA
GATTTGCTCTCTATATTAGAAAAGAATTAAAAAGAGAGATTTGTAACAAACTTAATTATA
GAGCTCAAGTCACTTCAAACAACTCTTAACGATTCAAAAGAATAAATTGCATAAGAATAG
AGTCAAGAAGAGCTATAAAAGTTGCTAGACACTCTAAAAGCATAAAGTATCAGACCAGAA
AACTACCAAGATTTAAAGTTAAAACTTAAGATATGTAAATGGCTTGATAAAACCATAGAC
AAACCTCTTTCAATAGACTTAATTGAAAATTACACTTTAGACTTCAAACTAGACTTAGTG
AAAGAAAAACTAAAAGCTATCTAAGATTAGATCAGTGTAAGAGCTCAGCCATATCTTGAA
AAAGTGAAAGAAAATAAAGATTCATTGGAGCAGTTAGTAGTCAATTTAGACTAGCTTGAA
AAACAACAGAAACTTATTGAAATTAATAATCATGTCATTCTATAGAAGAAAGATGAGAAT
AATCTGGTGGACTTCAAAGTGTGGATTACTAAAATATACACAGTAATTCAGAAGAAAAAA
CTGACACCTTCCAAAGGTATTATTGATCAGATTTAATCTATAAAGAAAGAAGAAGTGCTC
AGGTTAATTTCATTATACAAGCAATCATTTAATGAAATCTCTTAGATATCTCACACAATT
TATCAGCAGTTAAACGCAGTCAAACATTCAACAGATTTTACTCCTGTCAGTTAAGCAAAT
AGTCAAGTCAAAATAGATAAAGCAAAGCTCGAAAAACAGAAAAAGAAATATGAAAAAAGT
ACATCGCCCTCAGACGCAATTAAACTATAGTAAGTTGAGCTTTAATTGAAGCAAGTGAAT
GGTTGGTATAAAGAATTCAAGTCAAGTTGCTGTGTGTCAGAAGTGCAATTAAGAAAAGAA
CTGAAAGCTAATCCAAAAAAAGTACTTGAACTTGCTTAGCAATTATTAACAAGGTGA


>Contig361.1.g30(protein)
MVKRNKSKDSQQMLIVTKKAKEKSNIEDEEEVMEDVEEEKQIINNNEEESDVKIKKHKSK
TKVQKDRDDRTDQSNSQQNTNVCDADLDVIMTNESHSEMQRPVGKLDKMFKNTRSSPNRI
KVTNKMKDTTKISSAATSPRKKLGSQHQTKLFQAKVKICEVCFQISNCPLKDSGYDMIEC
KGXLMSQIIDEENQYVHVICGLISDLYEINDFGKMTFKKSPCFDQIQGFSKSKLGWEIDF
KLQDYSQQQNYKNTLDNYQFIKNTEFFDDDLSLKTPAKHISDQSNSTGDVKLKRKVKSGT
NQSKMNPDGSLKLNKMHSKLNLPLRGGKVSVVCDSHRSEQKSCVCNFLQSDPSTHKNSDW
IMCDYCEMWFHNKCIGLGPKELKEIDKYVCSKCESWSNQRMMIIAPALVGSQSKFNLLFP
QDKDSLNKYWEWKTWGNEIFPKERYKLKLIDMIFICQIWSEQAKQLISHYVTSELSKQQL
LRAQYIPLNTYSLILGINEKIEKVIEYEKQNSEIFEDYSYQDIKPVLIDGMKQEPNIEEN
QKLAQKFREVIDYEEQQLKLKSQRCEELEEFYELIETKIMLSDILSDKSKKISLEDIDKF
KQVYARADGYKCEMKSQLEKLVKEGKEAMTTFNPLIKKTEAVISSSIQDIVKTLSGKKSK
DWIQQNVFDKFKDSKIDYTKQFQKINLELNNTDKIASDLENAQILQDWIKAIQQSEKLIF
TNQTMTQQIEFYNKNKSWINQYIQLIDIKLKNQNKVSNLIDLLSILEKNQKERFVTNLII
ELKSLQTTLNDSKEQIAQEQSQEELQKLLDTLKAQSIRPENYQDLKLKLKICKWLDKTID
KPLSIDLIENYTLDFKLDLVKEKLKAIQDQISVRAQPYLEKVKENKDSLEQLVVNLDQLE
KQQKLIEINNHVILQKKDENNLVDFKVWITKIYTVIQKKKLTPSKGIIDQIQSIKKEEVL
RLISLYKQSFNEISQISHTIYQQLNAVKHSTDFTPVSQANSQVKIDKAKLEKQKKKYEKS
TSPSDAIKLQQVELQLKQVNGWYKEFKSSCCVSEVQLRKELKANPKKVLELAQQLLTR