Identifiers and Description

Gene Model Identifier

Contig14684.0.g27

Standard Name

PHD4

Aliases

Contig14684_0_g27

Description

DDE_Tnp_1-like zinc-ribbon

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006707004.0002685161515803e-16hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14684.0.g27(coding)
ATGTCTTTTTTCCAAAAGAAAGTAGCCCAGAGATTTAATAAAGAATAACCCCCACAAGAA
ACCTTAGAATAAAAGTTTCACACTTATTACTGTGCTGTATGCGGACAAATAGCTCTTGTT
ATGTCCCATAAACTAGAAGATCTAAAATTAAGAAGAACTGACGACGCTATGATAGTTGAG
GTGGATTAGCATTTTCATAAGAAACTTTTGTAAAGATAACCAAAATTCACAGTTTTACAC
AGAGAAAATGGCATTGAGAAATAGTTTAGATGGAAATGCAAAGAATGCTAGATAGTCATT
GGTTATTAGTGCAGCGATTTTTAAGAGGGAGATGAAATTAATGGGCCAGGAACGAAAGGA
AAAGATGCAGCCAAATTGCACGAAGAGAAAGAAATGAGGAGACATTTCTATATCAAGTAA
GGGGCTCTTGTAAGCGACACTCAAGATTCAGAGTTGCTGAGTAGAGTTAAAGAAATGGAA
GAGTAGATGCAGATTTGA


>Contig14684.0.g27(protein)
MSFFQKKVAQRFNKEQPPQETLEQKFHTYYCAVCGQIALVMSHKLEDLKLRRTDDAMIVE
VDQHFHKKLLQRQPKFTVLHRENGIEKQFRWKCKECQIVIGYQCSDFQEGDEINGPGTKG
KDAAKLHEEKEMRRHFYIKQGALVSDTQDSELLSRVKEMEEQMQI