Identifiers and Description

Gene Model Identifier

Contig17695.0.g33

Standard Name

PHD35

Aliases

Contig17695_0_g33

Description

PHD-like zinc-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam13771 ) PHD-like zinc-binding domain
  • ( pfam00628 ) PHD-finger
  • ( pfam13832 ) PHD-zinc-finger like domain
  • ( pfam14446 ) Prokaryotic RING finger family 1
  • ( pfam00657 ) GDSL-like Lipase/Acylhydrolase
  • ( pfam00130 ) Phorbol esters/diacylglycerol binding domain (C1 domain)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17695.0.g33(coding)
ATGGATGATATTGATTTTGAGCTGAAGCACAATACTGGTCAGAAAAATGATGGCTCAAAT
CAAAATGTAAACAAACTAGTTGCTTCTTTAAATGGTTAAACTTTTACATAGAACTTGAAA
GTCGTTAACTATATAATATGTTGCCCTACTTGTCATACTATGATACACTTAGAGTGCGCA
AATTATAATCTGTTCACCAATCAATGGTAGCAACAAAAAGACAACATTTTTCTCTTAGAG
TTGTAAAATAAAGATAAGTAAAGCCTTTCAAATATTGCCGTTGTGTTTAGTATTCAATGC
AGCTTCTGCAAATATCAGTAAAGCAATAATGATTCTGAGATGATGAACTGCTTGATTTGC
AATTAAGCTGTTAGGTATAGCTGCCAAGTGATCTTTAAGCCAGTGTCAAATATTTCATAT
AAGGAGTTTAAACAATCAAGCATGAAAGCTAAAAGTAAGAAAGATAAAGGAAACAGCTTA
ACAGATCGATGTTCATTTTGTGATACTTTAAACATCAGAGAGTTTTTGATTCCTTGCAAC
TTATCTGAATGCAAGTAAATGGTTCATTACTTATGTGCATTGAAATAATAACTTGACGTG
ATTGAGCATTCTCCACAAAAATCTTTCCCAATCTCACCAGTTAGACATATCAATTTGAAC
AATCAAGTTTACTGCTAAGACCACAGAGATAGCTATTTAGAAAAGCATAATGAGTAATCT
ATACTGTTTTAATAAGATTATCATGATTGTAAATTAGAGGATTTGCTTAAAATAGCCATT
ACAAGCAGTGAGTTACCCAACTTTTCCTTTCTAAACTAAAAAATGAAGCTTGCAATTTTT
GCGAACTAAATATATAAGCAACTTTTTTCAACAGCTTAATGTTTGGGACCAGATATGTTC
ACATTGATAAACTTTGAAAACAACTCTTTTTCAAGCATTAAAAATGCCTTCAAACAACTC
AAATTTTAAGGCTTAATTAACTTCAAAATCAAGCAATTAAATGGAGAGCTCAAATATCTT
TATAAGAGAACTTTAGAGACTTGTAGAGGAATTTAAGATGAGTAACTTCTGTACACTTAA
GATCAGAGTGAGGAGACATTCAACATGGTGCCTGAAGATCTTATAGATAGAGAAGGAAAG
TCTTCATTTGAGGCTTGGTACAGAAATTGTAAAAGATAACTCACTATTCAAGAATCTATT
GCCAATATTTCCTCAAAGTAAACGGAAGGATTTGTGGAAATCGAGGAGCCAGTTTTTTGC
ATTAATGATGACATAAAGAGATACATTAAGCTTTGGAAAACTCTAGATGTTCTGAATGAA
CTTTTTGCTTGGATCCAAAATAAGACTAAAAAGATTTTCACTCGAGTGTTGATTGATGCA
GTAAGCAACTTAAGAAATAGTGGGCATAATTTGAGTTTAACTTGCAAGTTAATCACCAAA
ATAACTAAACAAGTTGAGAAGAACAGGGAGCCAAAGTCTAAATTGTAGAAGCTAGCCGAT
AGCTAGAAACTACTAAATTCATTTGATTAGCTTGTTTAAGAATTGAGTCAGCGAGTTATC
TAAGAATCAACTATGTTTTAAATAGACCAAGAAATGCAATAGAATGAAGAAAACCCATTT
GATGATGAATAGAATTCGAATTAACCTATTAGAAAAAGGAGCAGTGCTTTTGAATTATTC
AGATGTACCTTTGGATATAGACAGTCATAACTTTCCCCTTCCCATTTAGATTCCTAATTT
CAAGATATTTGA


>Contig17695.0.g33(protein)
MDDIDFELKHNTGQKNDGSNQNVNKLVASLNGQTFTQNLKVVNYIICCPTCHTMIHLECA
NYNLFTNQWQQQKDNIFLLELQNKDKQSLSNIAVVFSIQCSFCKYQQSNNDSEMMNCLIC
NQAVRYSCQVIFKPVSNISYKEFKQSSMKAKSKKDKGNSLTDRCSFCDTLNIREFLIPCN
LSECKQMVHYLCALKQQLDVIEHSPQKSFPISPVRHINLNNQVYCQDHRDSYLEKHNEQS
ILFQQDYHDCKLEDLLKIAITSSELPNFSFLNQKMKLAIFANQIYKQLFSTAQCLGPDMF
TLINFENNSFSSIKNAFKQLKFQGLINFKIKQLNGELKYLYKRTLETCRGIQDEQLLYTQ
DQSEETFNMVPEDLIDREGKSSFEAWYRNCKRQLTIQESIANISSKQTEGFVEIEEPVFC
INDDIKRYIKLWKTLDVLNELFAWIQNKTKKIFTRVLIDAVSNLRNSGHNLSLTCKLITK
ITKQVEKNREPKSKLQKLADSQKLLNSFDQLVQELSQRVIQESTMFQIDQEMQQNEENPF
DDEQNSNQPIRKRSSAFELFRCTFGYRQSQLSPSHLDSQFQDI