Identifiers and Description

Gene Model Identifier

Contig22163.0.g75

Standard Name

PHD34

Aliases

Contig22163_0_g75

Description

PHD-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004447000.000005998506718272351PHD-finger family protein
SGDYKL005C0.0005997485943342685BYE1 SGDID:S000001488, Chr XI
from 434877-433093, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22163.0.g75(coding)
ATGTAAGAACAAAAAATTCAGGATCAATTACTTGGCTTCAGATCACAACTCGATCCATCG
AGATAGAAAGCACTTATCCAGAAACTTATGAGTGATCAGACCGACATGGCAACATAAAGA
CTTGCTCAAGCAATTCTTGAGTCATTCTCAAAGAGTGAAGTACTAGATTCCGAAAGGGAG
CGAGCATAAAAGATAGCACAGGAAATAAGTCCCTAAGGCAATACGTCTGAAGATAAGAAA
GACTTTACGAACAAGAAAATGTTAAATGAGGAGAAAAAAGTGGAACGTCAACCTTTTAAG
CCAAAGTCAGTTGTTGCTATCGATGAGAGAGAACTAAACAAAGTAGAACTAGCTTATTTC
AAGAGGCCCTTAGACGTTGTTATCCTAAGTGATAAGTACGTAAACCCTGTCGCTTAATCT
TTCTATAGGGATGCCAGCAGACTGTTGAAGGGTCAAGATGTGCCCCATCTTCACGGTTAA
AAGCGAATTCTTTAGACATATGGTGTCCAGCTGAATGGTGCCATTACAAGCTATAACTAC
GATGGTGATTCTGGTTAAGAGAATGAAACTAAAGCATAAAATGCAAAAAACCAAGCTCTA
GAATATGACGCAGAAGTTGCCTCAAATATGTCTCAGAGTGAATCAGAACCGCCTTACAAC
GGAAATGGTCCTCATGCAACCCCATTGAACTCTATCAGAAAATCAACAAACAATCATCAT
GGTCCCAGCACTTTCCAAAGAAGAGGCGGTATAGGTCAAAATATTAAGGGCCTCTCTAAC
AAGATAAAAACTAATAAGGGTAGAGTTTTACCCATGAGGCGTTCACACAATATGTCAGAA
GCAGGTTCTTAGGACGACGAGAGATCTGTAAAAGATGGCGATTCAGATTCGTTTAGTGAG
ATGAATAAAAAACTTTACTGCATTTGCTAGCAAGAGTACAAGCATGGAAACTTAATGTTT
TAATGTGAAGGTCCTTGTGAGGGCTGGTACCACCCTTAATGTGTTAAAATGCCCGAGGAG
AGAGTCTAGCACCTTAAAAACTCCAATGATCCTTGGATATGTGATTTTTGTCTTAACTAT
GCAAACGGACAAGCAGATTTGAATAACCAAATTTCCTCGGGAAAGCTAACCGCATGTGAG
CTAGTCGACTCAGCCAGCAAACACAAGAAAAAAAGGGATATTAAAGCCGCTTCCAAGACC
CTAGGTGGTCAATTAAATCTTTCACAAGGAAATAGCAAAGAAAGCTCAAAAGACATCGGT
CCTAGTTCCTCAGTCCAAGGAAATAACAATGGCTAAATATCCAATAATCAATCTTAATGA


>Contig22163.0.g75(protein)
MQEQKIQDQLLGFRSQLDPSRQKALIQKLMSDQTDMATQRLAQAILESFSKSEVLDSERE
RAQKIAQEISPQGNTSEDKKDFTNKKMLNEEKKVERQPFKPKSVVAIDERELNKVELAYF
KRPLDVVILSDKYVNPVAQSFYRDASRLLKGQDVPHLHGQKRILQTYGVQLNGAITSYNY
DGDSGQENETKAQNAKNQALEYDAEVASNMSQSESEPPYNGNGPHATPLNSIRKSTNNHH
GPSTFQRRGGIGQNIKGLSNKIKTNKGRVLPMRRSHNMSEAGSQDDERSVKDGDSDSFSE
MNKKLYCICQQEYKHGNLMFQCEGPCEGWYHPQCVKMPEERVQHLKNSNDPWICDFCLNY
ANGQADLNNQISSGKLTACELVDSASKHKKKRDIKAASKTLGGQLNLSQGNSKESSKDIG
PSSSVQGNNNGQISNNQSQ