Identifiers and Description

Gene Model Identifier

Contig2295.0.g35

Standard Name

PHD33

Aliases

Contig2295_0_g35

Description

PHD-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2295.0.g35(coding)
ATGCTACTTCAATAGTAAAATATCATGCAAGATCCCAATAACATGATTCTCTCTTAAAAT
TGTCAAAATCTACCACTTCAATAAATGGCATGTGTTGGAACTAATGGATTTCAAAGTACT
AATACTTTACAGTAGAAAAGTAATTAGATAATACAGTAAAATCAATAATAACATCAACAA
CAAAATTAGGCATAGTAATAGATTGGTAATGAACAAAAAATGTAACAACAATAGTAACAA
GATTAGTAGTAGTAGCAAATCGCAGCGGCTATAGATGCTGCTTAACTTTAGCAATAAATT
ATGAACCAAACCGCAGCAGCACTATAGCTATAGCAACTTTAACAGTAATAATAGCAGTAG
CCATTGCTTAATCTTGGTGTAAACGCTAACACTTCTTCGAGTATATCTCAATTAATGGGT
GCATCCCTAAACAGCAATTTACACTTGGGTAGTCATATGAACTACAACCAACCAATTCAG
CAATAGTAATAACAGTAAGATCCTTAAATTTCAATTTATAGAGGATTATATTTCTCGGCG
AGGCCACTCTCTTTGAAACAAATCTCTCAATAAAACATGCTTTAGAATCCTTTGAACTCT
AAGAAGTGCCTCGCTTGTAAAGAACTTAACACAGCCAAGACTTTACTGTGTTGTGATTTA
TGCTTGATACAAGTGCATTATGAATGTTATGGCTCCAGCACTTTTCTAAAACATTAATAC
GCTGGAAAAGCACTTGCTAATTTATAGTAAAATAATGGAAGCAATGCCCAAAACATCCCA
GGCATAACTATTTAAGAACCTTGGATTTGTGATAGATGTGAAGTAGCCGTGGAGAGTGCA
ATTGGGACACCCCTAAAAGACCTCGCGAATATGTTTTGCTATAAGTGTAAAGGAATTAAT
GGCCTAATGAAGCAAGTTATGTAGTCAGGATAATTAGAAAATGAAGATGGAGAAGTGGAA
GAAGGTGCTCAATAGTAATAACAGCAGTGCTGGGTTCACTATGACTGCATAATGATGCAA
AATAATGACGACTATATTCTATAAAATATGTAAAATCATATAGTAAGCAAAAGGAACAGA
CTTCTGGAGTTAAATGTTGCAAATTAATGA


>Contig2295.0.g35(protein)
MLLQQQNIMQDPNNMILSQNCQNLPLQQMACVGTNGFQSTNTLQQKSNQIIQQNQQQHQQ
QNQAQQQIGNEQKMQQQQQQDQQQQQIAAAIDAAQLQQQIMNQTAAALQLQQLQQQQQQQ
PLLNLGVNANTSSSISQLMGASLNSNLHLGSHMNYNQPIQQQQQQQDPQISIYRGLYFSA
RPLSLKQISQQNMLQNPLNSKKCLACKELNTAKTLLCCDLCLIQVHYECYGSSTFLKHQY
AGKALANLQQNNGSNAQNIPGITIQEPWICDRCEVAVESAIGTPLKDLANMFCYKCKGIN
GLMKQVMQSGQLENEDGEVEEGAQQQQQQCWVHYDCIMMQNNDDYILQNMQNHIVSKRNR
LLELNVANQ