Identifiers and Description

Gene Model Identifier

Contig17460.0.g112

Standard Name

PHD32

Aliases

Contig17460_0_g112

Description

PHD-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17460.0.g112(coding)
ATGTAAAGCCTCAAATAAGAAGATTTTAAAGAAATTGAAATTGGATTTTCAAAAATGAGA
CTTAGGCAGGATATTTAAGATTCATAGGCAGCAAATTTACCCTAAAAATCTTTTGAAGAT
TATGTCAAAGATCTTCAATGTGTTAATGAATAGATTAAGTCAGACAAATTTGACCCCATT
ATAACTTAAAGTGTACTTAAAGATTCAATGAGCTATATTTAAACACTTGATGACCATATT
AGATACAAACTTAAGTACCTTTAATCAAAGGACTCTAGCAATTATGAAATACTTTGCACA
GTTATCATTCAAGATTTAGCTGAGAATTGTTACACAGAATCTCTGGAGTTTCCAATTGGT
ATAATGCTGCTTAAATCATTGACTCTAGTCCTTATATAAAACATCTAGCTAGGCTAGGGC
AAATCAGATGATGATGAAATTTTAGGAGATCAATAAACTTTGGAAGTTTCTTAGAAAATT
GATTTAAGCCATAAACTTATTTTTTCAGATTTGCTTTCACATTTGCTTATACAAGCTTAG
CAAATAATTTCAATAAAATAGTCAAGCCAAAATTAACTTTGCTATTGTAACGAGAAGATT
AAAATTAGTTTCATAGAGGAAGATAATGATGAGTTGATTCAATGTACCTATTGCAAGACT
ATTTTTCATTTAGATTGTTTGAATAGAAGAGCCTTAACTTAGAAAGCATTCTAATGTCTA
GATTGTTAAGCTTCTCTGAAGGAATTTAGTACCTTTAGACTTTTGGACCTACATAATGAA
CTCAAGGATTTTTACACTCACTAGAGATAATCTTACCATGATTTTACAGATGCCTATGCA
TATGTAATTTTGAGATAATAAATAATAGATGATAGGGAAAAAGTTCAAGGAAAGAAATTG
AGATAGGAACTTGAAACAGAATACACTCGTGTTTAAGAATAAAAGTTTGACAAATCACAA
TTACAAGACCGCTCATGGATCTCAAGAGGACAATAACTAAGCATTCATTATATTAGGAAT
GTCTTGAAATACTTAAGTATTGAATTAGAACTAAGAGATGTCATTTATTTCAAGCATGCA
ACCATGAGAGCCAAAGCTATGAGGGCAATTAAAAACATTATTAAGATTAACTAGGAGAAT
TTTGTTGATCCTTAAATCCAGAAAATAATTTCATTGAGACTTTAAGATATTAGCTCTGGA
ACTAGAGAAGGCACTTTAGATTTAATTTCCTAATTTCTACAAAAGAGATATCTTGCATAA
AAACAAGAAAAGAGTGCTGATGATAACTCAAGTTTTCTCTTAAGAAAATTCTTGGAAATT
TATGGAATTGAAATAATTAACAGAGCTAAAGATTAGAATTCTAATGTACGCAAAAAGGCT
TTAGGCATTCTATCTTTGATTCTTTAAAATTTTCAACCCTCAACAAAAAAGAACAACCGC
GATAACTTTGATTTTCATAGAATAATGAGTACTTTAATTTAATCATGGGAGGAATCAAAT
TAAGATATCAAATAAGTTGTTGTCAAATCACTTAAGAAAATTTTGAAATCATAACTATTG
CAAACTCAGTAAAATTATGGCTAATCTATATATATGATACTTTTTGAAATCATAGAATAA
ATTGCCCAAGACTTTGGCTTTAAGGCTGATTAATAAAAAAACGAAATTAGGGTAAAAAAC
ATTGAAAATTTACTTATCAAAATATTTGGGCAAGTACTGGTTGAAGAGGATAAGACAAGT
AATAAAAGCAAAGATTAATCAATCATGAATTTATATGGAGAACAAATAGCAGACTATGGA
ATAGGGAGAATAATTTAAGCTTAAACCTAAGATTAAACAATCTAATTGCACACTCTACTT
TTGAGAACGTTAACTAAACTTTCGCCAGTCAGCTTTAGAAAGAAAATCAAAATTTTATCA
AACTTTTTAGCTTTTGGTAATGATTAAGCTTCTTAAAATTAAGGATCACAAAGTGATAAA
ATTAAGAAATCAGTTATTCAAATTTTAGCAATTATAATACAGTTCTTAAATTAGCACAAA
GATTCGGATTTTGATGATTACTTAACTCCTAAAACTTTAAGTGAAATTCTTAACTTAATC
TTAAATGTAATCAAGAACCAAAAGATTAAGTTACTTTATCCTGCAATTGAACTTGCTATT
GAGTTATCTAACTACTAAATGGAGTATTAAGAAGTAACAAAACTCTTTGTCCAGAGTTTC
GTATATGTTTAATCAATATAAAAAATGAGCCTATAGAAAAAATTCATTCTTAAGCAGCCT
TAAGTACTTACTCTGTCCAAATCTATTATGATTATCACAAAAATCAGTCATCTATCAAAG
CTAAAGAATCTTGATAACCTTTTAAAAGTTAACACTATAAAAGAAATTCAAGTCATGCTT
ACAAAACTAATCTAAGTAAAGGGTATCGACGAGTCTATAATTGATATGTAATTCCTATTT
TAAATCTTAATTATCTGTAGATCTTTAGAGGGACTTTCTTTGATTTGGATTCAACATCAA
TAAGTTCTCATTGAAAATTAGGAATGCCTTAAAATCTTCGAATTTATTCACCATGAATTT
CAAATAAAAAAGCTAAACTTTGACACAATGACAAGAGTAATTGATACTCTGCTTAATTTC
CTTAACATTTATGAAGTTAAAATGAAAGCAAATTAACAGAATGATATGTCTTAGTTTATA
TTACTCCTACAGCCTCATTTAATGGGATTCTTAAAATACTACGATTTGAAAAACATGACT
TTTGGAATTAGCTACAAGGAAGTTTTAATGAGAGTGTCCTTGGTTTAATTGATTTCAAAG
CTCTTTGACTTAAATTTGCTGCATATGATAGATGCATGCAAATTATTTATGATTATGGTT
TGTGATTGTCATCATGAGATAAAAAATATTGGAAATTTAGGGCTAGTTAAGGTTTCTTAG
AGAAAGTATGAAGTCATTGTGTCTTGTATTCAACCAAACAGCTTTGTTCTTAACCCTTAC
GAAATACAGATTCAGTTCTTATAATAGAAATCGAGCGATATAACAACTCACAACATATAC
TCTGATTTTACAAGACTCAAAATTTCAGAAGATTCAGATTCTTGCTTTTATGATTAAATG
CTCTTACTTTTGAATGAGAAATAACTAGACATTTTACCAAAGATCTTTGAAAATGTTCTC
ATATATTCAGACGAATTTGATTTAGAAATTGCTGATTAAAGTCCTACTCATTATAATCTC
AACTTTATTAGGTTTTGTGGTGAGATTTTGCTTTGCATCATCAAGAATGCTCCAAAATCC
CATGAATAATTTAAAACTACAATTGAAGATTATTTATTGAAAAATGAGGTAACTGTATAT
GAGAAGCTTAAAAACCAGCAAAAAGTATCAATAAAGTATTTGCAAAAATGCTTTATTATA
TTCATTTTGAGAGCTGGTCTGAGATTCATAGCCAAACTTATAAACCTTTAGAAAAATAGT
AATAGATATTCTTAAAACTAAGAAGAGCATGACTATAATATATTCCAAAAGTAAAGTTTG
ACTATGGAGAGTAATGAAGTGAAGTAAATGCAAAGAGATAAAGCTCAAAAATACTTCAAT
GAAATTATAGAAGAGTTCTAAGACTGGTCCTATTAAAACTTGAATGATTTATCCTAGAAG
TAGTATTTGAAGGTTCAGCATGAATTCAAAGACCACCTTAAGCTTTTAATGAAGGAAAAA
CAACTTCAATATAAACTCAAAATTGAGAAAAGGCTTTTTGGTAGGATCAAACAAATGGAT
GAAGTTGGCTATCGCTAAAAAGGAGTCAAAATTCATAATTAAAATAAAAACGACTCTGAT
GATGATATGATTGATATAGGAAGAGGGGCTGTTAAAGGTAATAGATAAGCCAAGTCAATG
TAAATTCATAAAAGCATCAATTAACCCTAAAACCAAAAGAAAAGAAAATTTGAATAGATT
AGTAGTAGTACCCACATCAACTAAGAACAAGTTGATATGAATTAAAATATTCAAGAGAAA
CAGCTTTAATAAGAGAATGCTAAAAGAAGGCAAACTGTAGCCATAAATAAAAAGGTCAGA
AGTCAGAGAGTTAGAAATAAGAATCACAAAAGATCAGATGAAGAGAGGTATAGCAGCTCA
AATAGTTCATGCTACAACTCATCCTCTGATTCAGAATATTGA


>Contig17460.0.g112(protein)
MQSLKQEDFKEIEIGFSKMRLRQDIQDSQAANLPQKSFEDYVKDLQCVNEQIKSDKFDPI
ITQSVLKDSMSYIQTLDDHIRYKLKYLQSKDSSNYEILCTVIIQDLAENCYTESLEFPIG
IMLLKSLTLVLIQNIQLGQGKSDDDEILGDQQTLEVSQKIDLSHKLIFSDLLSHLLIQAQ
QIISIKQSSQNQLCYCNEKIKISFIEEDNDELIQCTYCKTIFHLDCLNRRALTQKAFQCL
DCQASLKEFSTFRLLDLHNELKDFYTHQRQSYHDFTDAYAYVILRQQIIDDREKVQGKKL
RQELETEYTRVQEQKFDKSQLQDRSWISRGQQLSIHYIRNVLKYLSIELELRDVIYFKHA
TMRAKAMRAIKNIIKINQENFVDPQIQKIISLRLQDISSGTREGTLDLISQFLQKRYLAQ
KQEKSADDNSSFLLRKFLEIYGIEIINRAKDQNSNVRKKALGILSLILQNFQPSTKKNNR
DNFDFHRIMSTLIQSWEESNQDIKQVVVKSLKKILKSQLLQTQQNYGQSIYMILFEIIEQ
IAQDFGFKADQQKNEIRVKNIENLLIKIFGQVLVEEDKTSNKSKDQSIMNLYGEQIADYG
IGRIIQAQTQDQTIQLHTLLLRTLTKLSPVSFRKKIKILSNFLAFGNDQASQNQGSQSDK
IKKSVIQILAIIIQFLNQHKDSDFDDYLTPKTLSEILNLILNVIKNQKIKLLYPAIELAI
ELSNYQMEYQEVTKLFVQSFVYVQSIQKMSLQKKFILKQPQVLTLSKSIMIITKISHLSK
LKNLDNLLKVNTIKEIQVMLTKLIQVKGIDESIIDMQFLFQILIICRSLEGLSLIWIQHQ
QVLIENQECLKIFEFIHHEFQIKKLNFDTMTRVIDTLLNFLNIYEVKMKANQQNDMSQFI
LLLQPHLMGFLKYYDLKNMTFGISYKEVLMRVSLVQLISKLFDLNLLHMIDACKLFMIMV
CDCHHEIKNIGNLGLVKVSQRKYEVIVSCIQPNSFVLNPYEIQIQFLQQKSSDITTHNIY
SDFTRLKISEDSDSCFYDQMLLLLNEKQLDILPKIFENVLIYSDEFDLEIADQSPTHYNL
NFIRFCGEILLCIIKNAPKSHEQFKTTIEDYLLKNEVTVYEKLKNQQKVSIKYLQKCFII
FILRAGLRFIAKLINLQKNSNRYSQNQEEHDYNIFQKQSLTMESNEVKQMQRDKAQKYFN
EIIEEFQDWSYQNLNDLSQKQYLKVQHEFKDHLKLLMKEKQLQYKLKIEKRLFGRIKQMD
EVGYRQKGVKIHNQNKNDSDDDMIDIGRGAVKGNRQAKSMQIHKSINQPQNQKKRKFEQI
SSSTHINQEQVDMNQNIQEKQLQQENAKRRQTVAINKKVRSQRVRNKNHKRSDEERYSSS
NSSCYNSSSDSEY