Identifiers and Description

Gene Model Identifier

Contig20338.0.g79

Standard Name

PHD31

Aliases

Contig20338_0_g79

Description

MIZ/SP-RING zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003484902.000769134519826e-18MIZ zinc finger family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20338.0.g79(coding)
ATGATTTTATTTGATTTCATCATTTTATTCTTTAGACGAGGAAATTCTAGACAGCCGATC
AATGCTGGTTAAGGTTCAGTAAATTAACCGAGAAAGGTATAGCAGAAAGATTTCTCTGAA
AAAGGATTAGAACCTACAAAAGCTGAGATTTTTAAACAAATAAAGCACAAGGAAATGAGC
ATTGATGATATTGTAAAGCGATTAGCTAACAATCCCAAGGAAACTCTTATGAAATTCTAA
GAGAAATTAGGAAGAAAATTGGCAGATGAGAGCCAAACCTAAGAGTAGATTTTGAAAAAA
CTATGTGAGTTTCTGATTACAGAGGAGGGGAAACTTAGAGCAACTCACACTCTCTCAGTA
AATACCCTTAATGAAATGTATCTTCGTATAAGGAAAGCAGTACCAGCTTAGAACGAAGAA
AATAAGCTGCAAAGGTAGATGAATGAAGATGCTCTTAATAACACAGTGAACTCAACTCTT
TCTGCTCAGAATATTTCTTATCTGTCAAATGCGCAACAAGCTAATCCCATGCCAGAGATT
AGGCAGTCTGTATTATAGGAACAAATGGTTTCTCAATAATAAGCTAATCCTCCTAAACCA
TCAAGCAATATAATAGCTCAATAGTAGATTAGTCAAGTGATAAACTCAAATGATTCTGAA
AATATTAATCCTAATTTGCTGAAAAATAATTAAGATAAAAATGTCTAATCTTAGGCATAA
AAAGAACAAGTTATTGATTAGTCAATGCCTGATTAACCATCTTTGAAAATCCCAAATCCA
AACAAAAGGCCAAAGATATTGATTAATGAAAAGATAAATAATTTAAGATAATAGCGACTG
CAATTCCATAATTAAATTAAGTACAATTACAATGATTTAAGTTTAGAGGCTCTTGAATTG
AAAAGGTCAACCTTTAAGATTTGCTATTTTGATAGTTAACCTGCTTAAAATTAAGCTAAT
TTATTTTGTGTCTGTGAATCTTAAGCTGTAGCTAATCAAGAATTGCTTCAATGCACTGTA
TGCTAATATAAGTCTCACAAAGCATGCATGGGCGATAATGCTAAAATGAAGAGATTCATT
TGTGCTCATTGTTAGCTTTTGTACATAGATCCGCTTTAACTACCAATCTAGACATTGCTC
AAGCCTTTTTAAGTGCATTAAGCTTCGCAAAAAGAATTATAGTATAAACAGGGAAAGTTT
AGTTTCAAATTCCCTCCCACAGCACAAAAGAAATTCGCTCTCTAATAAAACATTCTTGAT
CAAATCTTAACTTTTTATCATAATTCAAACTCTCCATAGCTATTGATTCAAGTTAGATGT
ATCAGGATGAACAACGGCGATGCTCTGCTAAATAATACCTATCCATAGTTTGGATGCATG
GCATTGAATCAATCAAGCAGGAATTCTATTAAAAATGAGTTTACGATAAAGGATCCTCCT
AACGACAAAAAGAGAATAGATAAGATCATAGACGTGACCAAATCCTTGAAATCTGGTGAT
AATTTACTTGAACTCTTTTAGATACTTAGACCAGATAGAGGGGATACTCACAAGTATGTT
TGTGGAGTTTTCATTGTAAAGAATTATGAAGAGAAAGAATTCACTTCTTACATTAAAAAT
CTTTAACCAGTTATACCATTCCAAGAAGGACTTGCTATGATATCCAAGCGATTTTAGAAA
TCAAATAATGATGCCACTGAGGACTGTAAGATTGAACAATAAGATGTGAAAATAGATTTG
AAGTGCCAAATAACTCAGAAGAAAATTTAAGTTCCAGTCAAGGGATAATGGTGTGAGCAT
GACCTTTGCTTTGATTTGGATAATTACATCGCCATGAATGCGAGACCTACTTGCAGATTA
TTCAAGTGCCCATGTAGACCTAGCGATAAACCTGTAATTCTAAAGAGAGATGAGTTTACT
ATGAGACTTTTGGAAATCGCCAGGCCTGAAGAAGATACTCTTTCAATTAATGAAAATCTA
GAGATTATGTTCAAAGACAAAAGGACTTATATTGTAAGAGGAAATAAGTTTGCTCTCAAG
GATTCTCCCATAGAATCCAGCTCAGAGGATGAAGAAGAGAAAGACTTTGTAGCTTCTCAT
CTGGTAAACTCTTCAAGCAAGGAGCAACCTCAAAATTAATAGTACCTTACTAAACCTCAA
GAAAGTAATTCCTTGAAAAGAACAGTCAATTAAAGAGAAAATGAACAGTAGCCTTAAAGT
GTGCATGCCTTCACATATGAGAAACAGAGCTTTAGTAATAATGATATTCAAATTGACATT
GATTGTTCAGATGGATCTGACCTCTAATAGCCTTTGAGGAATCAGTATCAAGCTAATGGA
TTGAATAGTTTTCCAGGTGAAGACCCCAAAAAGAGATAAAAAATAGGCTTTTCAACATCT
CAAGCTTAGTAGTAATTTTAGTCTTACTAACCTGCTGTATCTCAATAGCAGTAAATACAG
TAGTAGTATGGTTATGATCATCAAATGTACCCTTAAATGATGTATCAACCTATGTATCTC
TAGAACCAAATGCAAATGAATGGTTACTAAGGAGTCAATAATATGATGAACATGCCTTAC
TAGCCAGACCAGTCTTAGTACTTAGCCATGTAAAATCAATAGTAGTAGCAGTACATAATG
AATCAAGCAGGTTAATTTGGTTCTCATTCATAGCCTCAACCTTCTTGTACAGAGATCCTC
AAGTCTACTGCTTTTCATTCGAATCAAAGAGAGTTTGCTGATATGTTTCAGCAATAAAAT
CAGAATGAAGTGCAGAAGCAAACTCAGACTCTCTAAGCAATGAGAATGAAAGATTTGGTG
CCAACCAACTAGTAATCTTAATAAAAATCCGCTCCCTACAACAAAGCTCTCAATCAAAAG
AGCATGATTGCAAATGGATTCCAAGGTGATATTGCAGCAGGTCATCATACTCCAAATGCT
ATGATGAGCAGAAGCAATGCTATAGGGGACGTTGCAAACAGCATGATAAACGGGAAAGAG
AGTAAGTCAAATAACTAATTTTAATCATTAATTTTAGAGAACAAAATTATTAGTACTCAC
TTGAGAGAATCTAATCCATTACCTATGAATGTCAATACATCCAATCAAATGAATCAAACT
ACTTTCAACTCAAAAGATCCAAGGAACAAAAGCTAACCGCCAGTGAATAGGACTTCTACT
AGCTTCATGCAACAAGGGGCTAAGCTATCGCCAATCAAAATCCAAAATCCTTAGATGTCA
AATTAAAACATTATTTCACAATAAAAATCTGGAATTTCAGCTCTTCCATAGCAATAAACT
TAGTTCCATCATGCAAATTCAAACCCTTAATAAGTATCTATCTAGTAAAATATTCACCCG
CACATGCAATAGCAACCTATGAGCAGTCCGACAGCACCATTGGGTCACGGAGAAGTCATT
GAGATTGATGACTGA


>Contig20338.0.g79(protein)
MILFDFIILFFRRGNSRQPINAGQGSVNQPRKVQQKDFSEKGLEPTKAEIFKQIKHKEMS
IDDIVKRLANNPKETLMKFQEKLGRKLADESQTQEQILKKLCEFLITEEGKLRATHTLSV
NTLNEMYLRIRKAVPAQNEENKLQRQMNEDALNNTVNSTLSAQNISYLSNAQQANPMPEI
RQSVLQEQMVSQQQANPPKPSSNIIAQQQISQVINSNDSENINPNLLKNNQDKNVQSQAQ
KEQVIDQSMPDQPSLKIPNPNKRPKILINEKINNLRQQRLQFHNQIKYNYNDLSLEALEL
KRSTFKICYFDSQPAQNQANLFCVCESQAVANQELLQCTVCQYKSHKACMGDNAKMKRFI
CAHCQLLYIDPLQLPIQTLLKPFQVHQASQKELQYKQGKFSFKFPPTAQKKFALQQNILD
QILTFYHNSNSPQLLIQVRCIRMNNGDALLNNTYPQFGCMALNQSSRNSIKNEFTIKDPP
NDKKRIDKIIDVTKSLKSGDNLLELFQILRPDRGDTHKYVCGVFIVKNYEEKEFTSYIKN
LQPVIPFQEGLAMISKRFQKSNNDATEDCKIEQQDVKIDLKCQITQKKIQVPVKGQWCEH
DLCFDLDNYIAMNARPTCRLFKCPCRPSDKPVILKRDEFTMRLLEIARPEEDTLSINENL
EIMFKDKRTYIVRGNKFALKDSPIESSSEDEEEKDFVASHLVNSSSKEQPQNQQYLTKPQ
ESNSLKRTVNQRENEQQPQSVHAFTYEKQSFSNNDIQIDIDCSDGSDLQQPLRNQYQANG
LNSFPGEDPKKRQKIGFSTSQAQQQFQSYQPAVSQQQQIQQQYGYDHQMYPQMMYQPMYL
QNQMQMNGYQGVNNMMNMPYQPDQSQYLAMQNQQQQQYIMNQAGQFGSHSQPQPSCTEIL
KSTAFHSNQREFADMFQQQNQNEVQKQTQTLQAMRMKDLVPTNQQSQQKSAPYNKALNQK
SMIANGFQGDIAAGHHTPNAMMSRSNAIGDVANSMINGKESKSNNQFQSLILENKIISTH
LRESNPLPMNVNTSNQMNQTTFNSKDPRNKSQPPVNRTSTSFMQQGAKLSPIKIQNPQMS
NQNIISQQKSGISALPQQQTQFHHANSNPQQVSIQQNIHPHMQQQPMSSPTAPLGHGEVI
EIDD