Identifiers and Description

Gene Model Identifier

Contig18375.0.g83

Standard Name

PHD29

Aliases

Contig18375_0_g83

Description

PHD-zinc-finger like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR031W0.000000000000020000882446601127NTO1 SGDID:S000006235, Chr XVI
from 631515-633761, Geno...
T. thermophilaTTHERM_003131400.0000000000010000211161514907PHD-finger family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18375.0.g83(coding)
ATGAGTTCAACTCAAGATTCAGAAGAAGACTCTCAAAATATTGAGGAAATCTTAGAACAG
AGAAAGTCTAAGGATTTAAAACCATTGCTAAAACCAAGTTAAATTAGTAATTCTACCATT
CAGCTTTCCACTTTATCACCTTCTGAGAGAGCAATTGTCAACGATTCTTACGCATCATAT
TTTTCAAATATTGACTAAGAGTTAGTTCCACATGATCATCCAAATGGCATAACTCACTAG
TAACTGCAATAAGAGATTTAATTTTAACAGCAAAGATAAGAAGAGTCTTTGAAAAGATTA
GAGGTATTAGACTAGAAGCAAGTTTTCTGCAAAAAAATGGGTGGGATTGCAGCCACTATT
TGGGATCCAGAGAAGAAAATTTATGTTACAAACCCCCTCTTGAAAGAGTTTGAATCACAG
TATAAAAGTATGCCCAAGGGTATGCGGGAAGAAGAGCTTATCGAGATTTAGAAATGTTTC
AGTGAAATCGTAATGCTTGAACATAAAGATTGTGATGATAAGCTTAAATGCGATATTTGC
TTGGATAATCAAAGCCAAGAAGATAACTAGCTTGTGGTTTGTGAGATATGTTTAGCTGCT
ACTCATTAAAAATGTTATGGATTAGATTTAAAGGATAGGGTGCCTGAGAATGTTTGGCTT
TGCATAAGATGCAAATATCTTAAATAAGAGTACAAAGATGTTCTAGCTTCCAGTAACAAA
AGAAAATTAAGCGAAATTAGCAGACCATTTTGCTTATTTTGTAATGATTTACAAGGAATT
ATAGTTCAACTGCAGGGAGGACCACTCTCAGATCATTGGGTTCATATAGTTTGTGTTAAT
TGGAGCAATTAATGTTCTTTCATTTTGAACTATAACAGAGAACTTGTATATTAACTAGAT
AAATTGCCCAATCCTAAATCCTTAAATGAAGCTGAAAATGTTCCATGTACAATTTGTGAA
GATTCTTCAGGGTATCTGATAAAATGCGATTATGGAGATTGCTAAGAGTAATTTCATGTG
AGATGTGCTATTATTAAAGACTATATCAGGCCAAGACTTTAAATGAATGACTAGTACAGC
AAAGTGATGTTTGGTATGGCTTACATTTTCTAATTGAGAGTTTAAAGAGTTTTGAAAGTA
TCCCCTAAATTCAAGGAGAAAGAAGCACTTCAATAAAAGGAATATACTTTGAATTAATTT
CAAGATAAAATATAGCCTATTAATAAAGATGGTTAAAAAAGTTAAGATAAATAACAAGAA
GAAACTTTTGAGTTTTAGACAGATGATATAGTAACTTAAAAGGTCTTAGTTTAAAAAGAA
AAGGTAAAGCTAGATTTAAGCACAAAGTCTAAAGAAAAAAGTAAAAATAATGAATCTCGG
TCTAAGAAGAAATAAAAATGTAAAGAATAACTTTCTCCACTTCAAGAGAAAGTATAAGAT
AAACGCACTTAAAATAAGCGCAAAACTCGATCTTGTGTTAAACTTTAAGCAGAGTCATCA
GAAAGTGAACTTTAGTAATTACCGCAAGATGAAGCAAGTAGTGAAGAGGAGGACTTTAAG
AAAAAGAAAAAACTTCCTTAAAAAAATAAAAGGACAAAAAAAGAGTAATAAAAAGCTAAG
AGTTCAAAAGACTCATCCAAAAGTACTTCAAAGACTTCATCAGCCAGTAAATTAGATAAA
CTCATTTCAGATAAGTTCCAAATAGACAAAAAGAAGCAAATTAAAAAAGCCATTAAGAAG
TCTGATGAACGTGACAAATTCTTATCAAAAGGCTACAGTCCCTTAAAGACCTTACCTAAA
CCTCAAACATCCGTCTCTAATTTAGCAAAGTCAGCTCTTGCAATAAACAATACTTCAACT
AATTATTCAAGCGGTTCAAATTTGACACCTTTGAAGCAACCATCGCCGCCCAAATAAATC
TCAGGAATCAAAATGCACTTGTTAGTTGAACAAATCTTACAGTAGTAGCTCTTATTGAAG
CAATAGTAAGAACTTTAACAGTAACAGTTAAGATAGGAGCAAATTTAAACCTAACAAGAT
ATTTAAAACTAATCTCAACTTTCAATGATACCAGATTTGTTTAACTATCAAACTTAACCC
TATGACATGAATCTGGAGATTAAGAAAATTCTAAATGAATCTACTAGTAAGAACAAAAAT
GATCTGTTAATAAATGAAGAAGATATAACTTCTCAATCATAACCATCGAATAATGCCCCA
TCTCTGAATTAAACTCCCAAATAATCTCAATTTCCTTAGTAGTTAAGTAATTACAATAAA
AACACTCCATAAAGGCATTATCAAGCAGATCGAATAAAGCTTGTACAAGTAAATAGTGAC
CTGGCAAAAATGCTTAAACTACCTAAAGTTATTGTAAAAGTTGAAGATTTAATAGTAAGT
TTCAAGGAATATATCTTATAGAAGGGAATCCTTCGAATACAAAGCTTCTAGGATGGAGAA
AATGAAGAAAGTTAAGAAAGCGATGAAGAAAATTAAATGCCAAAAAATCAGCAGAAATTC
TTTATTGATCTTACTCATGATGATGAAATGCGAAATTTAATTGGGAGAGAAATCATCAAA
GGAGTGATTGAGGATGATGGAGATTTAGAAGTGCATATATGGAAAAATTTAGAGAAATTA
GTAAATATTCTAAAAATAGGCTTGTGA


>Contig18375.0.g83(protein)
MSSTQDSEEDSQNIEEILEQRKSKDLKPLLKPSQISNSTIQLSTLSPSERAIVNDSYASY
FSNIDQELVPHDHPNGITHQQLQQEIQFQQQRQEESLKRLEVLDQKQVFCKKMGGIAATI
WDPEKKIYVTNPLLKEFESQYKSMPKGMREEELIEIQKCFSEIVMLEHKDCDDKLKCDIC
LDNQSQEDNQLVVCEICLAATHQKCYGLDLKDRVPENVWLCIRCKYLKQEYKDVLASSNK
RKLSEISRPFCLFCNDLQGIIVQLQGGPLSDHWVHIVCVNWSNQCSFILNYNRELVYQLD
KLPNPKSLNEAENVPCTICEDSSGYLIKCDYGDCQEQFHVRCAIIKDYIRPRLQMNDQYS
KVMFGMAYIFQLRVQRVLKVSPKFKEKEALQQKEYTLNQFQDKIQPINKDGQKSQDKQQE
ETFEFQTDDIVTQKVLVQKEKVKLDLSTKSKEKSKNNESRSKKKQKCKEQLSPLQEKVQD
KRTQNKRKTRSCVKLQAESSESELQQLPQDEASSEEEDFKKKKKLPQKNKRTKKEQQKAK
SSKDSSKSTSKTSSASKLDKLISDKFQIDKKKQIKKAIKKSDERDKFLSKGYSPLKTLPK
PQTSVSNLAKSALAINNTSTNYSSGSNLTPLKQPSPPKQISGIKMHLLVEQILQQQLLLK
QQQELQQQQLRQEQIQTQQDIQNQSQLSMIPDLFNYQTQPYDMNLEIKKILNESTSKNKN
DLLINEEDITSQSQPSNNAPSLNQTPKQSQFPQQLSNYNKNTPQRHYQADRIKLVQVNSD
LAKMLKLPKVIVKVEDLIVSFKEYILQKGILRIQSFQDGENEESQESDEENQMPKNQQKF
FIDLTHDDEMRNLIGREIIKGVIEDDGDLEVHIWKNLEKLVNILKIGL