Identifiers and Description

Gene Model Identifier

Contig8298.0.g53

Standard Name

PHD27

Aliases

Contig8298_0_g53

Description

linker histone H1 and H5 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8298.0.g53(coding)
ATGAGCACTAATAATATATTGATACCATCCAAGACTACCCCTGTAGAATTTGGAAGTTCA
TTTTGTGGCAGTATAAGCACCGGAAGTGAATCGGCCTACTAAGAATTCGATTCTACAAAT
AAACTACTCTCTGACACCTAACTTTCGGGTTAGGACCGCAAATTCTATGGGTCACCCAGT
GAGATTTCAGAAATCTAGGATTAATAAGAAGAATAGGAGGTTTTGATTTTAAATGTCGTC
CCTCTAAAAGACCTTCAGGAATAGGAAAAACAACTATGTCTACATACGTAAATATTCATG
AGAAAACATGCCTCTAATATAAAAAAGCAGCTACTACTGAACTCAATCAACTACAAGCTA
AGGAAAGAGGGAAATTCATTAGCTCTGGTTCAGAGAGCCAACACAGCTGAAGATCAAGCT
TACCAAACAGAATTGCTAGTATTGATAAATCAAGGTCGATAATAGGAGCAACTAAACCCA
AGGGTGAACGAGAATTTAAATTTGACTCCTAATCTTTCCGATATTTCTACAAACCTTACT
GATTTCCCAGAATAACAGCTCTTATGTATTGCAGAGCACCCTATGATAGTTGAGTATTTT
GCAAATAACCTTTAACTTTTGTACTGGCTTGAGCGTCTGAGACCTTTCCTTCTAAAAGAA
TGGAATCATTAGCAGTAGGTGGTAAAAGCCTGCTACCAGGAACAGGAGAGTGCAAGCGAA
ACGTTCTCAAGCAAGCTATATCCTCATTTATGCTGGCATAAATCCAAGAGACTCCTCTCA
GTCAATATGCTTGAAGCATAGGCTGAGGAGATGAAGAATATTTCTAGAAGTCAGGGTTAA
ATGAATATCTTCGATTCCAGATACATCACAGAATCAATTGAACTATTGAAGGAACAAAAA
GGAATCTCAAAGCTAAAAATATCCAAGGCAATATCTCAAGTGAAAGATTCTAAAAAGATG
AAAAATAAAGTCAAGCAAGCCTTGGAAACTCTTTAGTTATAACAGCTGGCTAGAGAGTCG
AAATACTCAGAGTGCTGCCACTTCCAAGAGCAAAATAAGGTTGAGAAGATGGTATTTAAT
AATCATATTCAAAAGGATAGTAAGGTCAATGCAGCTTCTATTAAATTGAAGGGCATTAAT
AAATAGGAGAAGTGCAGTGAAATTTAAGGTAAGATATAAATAAACCTTAACAAACCAGCA
CATTCACAAATACTGTAAAATAATTCTCAATCTACTACACATGACTAAACTGAAAATATC
CCCAAAATGAGGGATGAAAAGAAAGAGACTATCCTGACTTGTTCTTATTGCTAGGGAGCG
TATCACTTGGGCTGCATAATTTCTGACCCTAAATGGAACTATAATAAGATTATGTCATCA
CAATCAAGTTAAAACACAGACCTTATAGCTGATTAAGTTAATTAAGGTGCAGTCTATAAA
TAAACATAGATTTAAAAAGGATATCAAATGAGTTCTAGTTCAATATAAGAGGAAGCAAAA
TAATCTGGAAGAGGCAAGAAGAGAAAAAACACTATCTCAATTGATGAGTTAGAAAGTGTT
GTTAGCAATGAGGCATCTATGTCAACTTCTTCGATAACATTGAACAATTCAGGATAGTCT
AATTATAATAATTAGGGTAATTAAGATCAAACTTTTGATCCAAGCATCCAGACTTCCAGC
ACTTAAAAATTTGCCTCTACTTCTGCTCTCAATAGAAAATCCTCTTCTTTGATAGAGAAA
CCAAATTAGCAAGGCCAACTATCGGACAGTTCATTCTTTGATAATAGTCCATTGAAATAA
TTGGAAAATTTGAGTAAAGACGAAATAAATTAATTTTTGGCGAGGATTGGCTACTCTCAC
GATAGAGCGACGAAATGGGCCTGTAAAAATTGCTTGTTTAGCTTTATTGTTGATCATCTA
TCCTCAGGTGGAGACCTCAGATTTTAAAATGAAGTAGCCCAGTCGAATTTCGAGATGATA
AGTGTTTGCTAAGAGCAATCTCTTGAGAGCAGTAACACTTTAAAATACTAGAAAACCAAA
TTTGATAGCGAAGCATAACCACCAAGTAATAATTCGTTGTATGAAAAATATAACAAAGAT
AACCAAAATACACACTTAAATTCAAGTGGTTTATAAAGCCCATAAATTCCTTTAAATAGC
AAAAATACTCATAAAGCCTAGACTGCCAAACAAAAGAGCTAAATGTATGCTTTATCTAAA
AATAACGGCCTCAAAGTCCAATTATTGAAGTAGCAAAAATCTTGTTAGTGA


>Contig8298.0.g53(protein)
MSTNNILIPSKTTPVEFGSSFCGSISTGSESAYQEFDSTNKLLSDTQLSGQDRKFYGSPS
EISEIQDQQEEQEVLILNVVPLKDLQEQEKQLCLHTQIFMRKHASNIKKQLLLNSINYKL
RKEGNSLALVQRANTAEDQAYQTELLVLINQGRQQEQLNPRVNENLNLTPNLSDISTNLT
DFPEQQLLCIAEHPMIVEYFANNLQLLYWLERLRPFLLKEWNHQQQVVKACYQEQESASE
TFSSKLYPHLCWHKSKRLLSVNMLEAQAEEMKNISRSQGQMNIFDSRYITESIELLKEQK
GISKLKISKAISQVKDSKKMKNKVKQALETLQLQQLARESKYSECCHFQEQNKVEKMVFN
NHIQKDSKVNAASIKLKGINKQEKCSEIQGKIQINLNKPAHSQILQNNSQSTTHDQTENI
PKMRDEKKETILTCSYCQGAYHLGCIISDPKWNYNKIMSSQSSQNTDLIADQVNQGAVYK
QTQIQKGYQMSSSSIQEEAKQSGRGKKRKNTISIDELESVVSNEASMSTSSITLNNSGQS
NYNNQGNQDQTFDPSIQTSSTQKFASTSALNRKSSSLIEKPNQQGQLSDSSFFDNSPLKQ
LENLSKDEINQFLARIGYSHDRATKWACKNCLFSFIVDHLSSGGDLRFQNEVAQSNFEMI
SVCQEQSLESSNTLKYQKTKFDSEAQPPSNNSLYEKYNKDNQNTHLNSSGLQSPQIPLNS
KNTHKAQTAKQKSQMYALSKNNGLKVQLLKQQKSCQ