Identifiers and Description

Gene Model Identifier

Contig18769.0.g73

Standard Name

PHD25

Aliases

Contig18769_0_g73

Description

START domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18769.0.g73(coding)
ATGGAGTTTGAAGTTAAAAAATAAGGGCCCTATTTCAGAAGCCCAGCCATCTATTATACA
GTGGTTAGCAAGCGCCTAGAGAACCCAAGTTCTTAGACTAGCAAACAAGCCAAGCATCCT
GAGCTGACAACTCAATGCAAGCCTCTCAATCCACACAACCCAGCCACATTGCCTGTTGCC
AACCTAAGAATCCGCACGCTCAGAGTCATGACTACCACATCTCACCAGACTCAAGGAGAT
CCAACTGCAGCTTTGCTGACACCGAGGCTCCGGGTCTCAACAAACCTACAGCCTTACTCT
CCAAGAATCTATAACGGAAACGCTTATATATAGATACATGAACAATGGCGGGACTCAATT
AGGAGATTAGAGTAGATGGCACAATTTATGGGTCTAAACTTTAATGAAATTAATTTAATA
ACCTATCTCATTTAACATTAATTAATTTAAACTCGTAGAAATAATAAAATGACTGATTTT
ACTAAAAGATACTCATCTCTTCAACTAAACAAGAATTAAGATCCTCTAAAGTATCTGAAT
GAAGTTTAAAGAAAAATGAGTTTCAACATGAATGCAAATAATGTTATAAACTAGAAAAAA
GTTGAAAATTCTTCAGTCTGCGGTTTGTGTCATGCTATACTACAAGATCCCATGTAGTGT
AACAAATGCAAGACAAATTTTCACAAATCATGTCTTTTAATCTTTTGCAAAGAAACAGGC
AAATGCCCTATGAACTGCGAGAATCCAAAGTTTAAGTCTTTATAAAAGAAGAGATATTAA
CTTATTAAGATGCCACTTAGCATCATGAAATTTGCCAATATCTCACAGTTAAGTGTGAAG
GGTTCAAAGATTCTACACTAATTGGTTGATGAAAAGGCCTTGATATCAGACTGTGTTTAG
AATGAAATTTATCGAAAAAATACTTTTGCTAGAAAGATTTTAGACCTCTAAAGAGAAAGT
GAAGTGAAACTTTCAAATTTACTTAAGGTATTGGAATTCGATGAATCCAAAATTCAAAAT
AACTAAGCAGGAGATGATGTGGACAGAGTAGAATCTTAAATATGGACTGATTCTAGAGAC
TATGTTTAGTCAATCGATCAATATTGTAGTCATGAAATATCTGATAGAGTGATCTAATAA
GTCCTACCTAAAGTCCCTATTGAACTTAGGGAAGAATTTAAAAAAGCTTAAGAAGTGCTG
ACAGAGGCAAAATTATTTATTAAAAATAGACAGTTTAAGAAGGAGTCAATTAATTCGAAA
TAATGTAGAAAAAACTTTGATGATATATTTGATAGTCTCAGAGTAATTGCTGATTTACCT
CTGGATACTTAAATATTTCATATAACTTAAAAGAGATTCTTAAATGTGGAGGCTAGAGAT
TTTGTAATTTTTTAAAAGATCTAAAAAGTAACTCCTTATGAGTATTTCATAGTTCACAAA
AGTGTATCCGCTGATACCTTGAACTATTTATCCTAGAATGATAAACTATCAAGAGAAAAT
ACCGAGAATGAACTGATTCATTGCTAGATTAACATCAGCGGTTTTAGATTGAAGTATATG
ACTAAAAATCGTACTCAAGTGACTTATTTCTCTGAAATGGATTTGAAATTATCAAAATTC
ATTCAGTAAAAAGTTTGTTACAAATATACAGATATACCAAAGAAACTTAAATTGTACATG
GAAAGTCAAACAAACCATACTAAGAAAAGTAAAATTTAGGACAAAGATACAACTGATTAA
GAATATTTTGAAGAGAGCCATAGTGAAGATGAGAATTAAGAAATAAATGAATAGCAAGCT
TTGATGAGGGAACAGCTTGAGAAGAATAAAAAAGAACTTAAAGAACTAAAAAGAGAAATC
CAAAAAATTAAGATCAAAATGAGTGATTTACCTGAGGATTAGAGAAACGACATGCTAGAT
AGCATACTAATACAGAAAGACTCAGTTGCTAATGACTATAGATTTTTAAATAAAGTCATA
GATAAGATCAATGTTGGTACTTATGACAAGAAAAAGCTACAGGAAAACTTGAAATTCATA
TCTGATCTCAATCAATTTAATTTAAAAACGAATTTAATAAAAGGTGGACGAAGCTACAGG
GACAACACATAGAAAGTAGCGAATTTGGAATCTATAATCAGTCGGTCAATTCAAGCTCAA
TCACAAACTTCCAGAAATAGAAATGAAACTTTACAGCTAAAAAGCGAAATCTAAACAGAG
AATACTAGAAATAGTAACTCTATTCTTGATATAATTGATGAGAAGAATGAGACAATAAAT
TAAATCAGATAAAAGGAGTTACTCATGAAAATTAAAGCAAGCATGCAAGATTAAATGCAG
AAATTGAAGGTAAGAAAGGAGAGAAATAAATCTTATGGATAAGTTTAAGATAGGATATCC
ACTGGAAGACAGAGTATGCAAAGCAAGCAGGATAGTTAAACTGTAGAAAAGGATGAATAT
GGATGGCCTATAAAATCTCATGAAAGCCGATAAATGACCAGCGTCAGTGGATCTATGGTT
GCTTTTCAAAGAGGTATGCTATCTTAACTTAAACGTAAACAGCTTGAAATGAATTTACTC
AAGAGTCAATTGAAAAGATCTAACGATATTTAGAAAGTTAAAGATTAAAATTATATTGAA
AACTAAAATAGATTCGGTAGTCTTCATACTTCACTTTTGGATAGTGAATCTTCAATTACA
AAGAATGAAATTAAAATCTAAGAAGATTTTATTCACATAGAAAATCCAGTTAATGAACTG
GATTTTAATGAAAGCAGGATAAATCCAGCTGAAGTTATAATATAGGAGGCTATACTATAA
GATAAGGATCCCTAATAAGAGAGGAATTGGAACGAAAAGAAGTTTACATAATAACAACCA
AAATAAACTGAAACTCAAAATTATTGCTTTATGAAAAGTCCACCATCACATATGATGTCG
AAATTTTTCAAAGGCTTAAAAACATCGAGATCTACATAAAATTTGAAATTAAAAGAAAAA
GATAAAAAGCAAAAGAATTAAATGAGTAGCAATCTTCCTGATATATCAAAGCACATAGAA
TTAAAGAATATTAACTATGAAAGCAATTTAAGTGGGTAAAAGTTAATATACTTGCAAAAT
CATTTGGCATAGGCAGCAATACCAAGTATTTTTATGAAAAAGAGTCACAGTCGAAAGCAA
TTATTTTCAAATTTAGCCCCAGCTATTTAATTCTCCAAGTAAAATCATTAGAAGTTTGTA
AAAAATGCTTTGAAATATAATTAAGGCACTTTAGCAAAGGTATCGAGCGAGGAATTCTTA
CAGGCTTTCAGGACTTTATAAAACACACCACAATAAAACCCTAAAATTGAGCAAATATTT
TCAAATTAAATACATGAAGTACCAACAACAGCATATACAGATACTTTCTAGTAGCAACTC
CTTCATTCTGATATGCCAGAATAAGAATATTTAAGCGCTAAAAAGTAAACAAAAAATTAA
AGCATTGGTATGCTAAAAAAGAAATCATCAAGTACCATGATCCCTATGCCAATGACAACT
CGGACTTTCTCTCCACCATTTGATCCCAATTTATTTCATAATAAAAAGCTATAAGAAATT
GGTACTGGAATTACAAATAGTAGAAATTATGGATAAAATTCTTCTACTCTTAACAATGTT
ACTAAAAAGTAAAGTTCCTTAGAAAATAAAATTAATATATGA


>Contig18769.0.g73(protein)
MEFEVKKQGPYFRSPAIYYTVVSKRLENPSSQTSKQAKHPELTTQCKPLNPHNPATLPVA
NLRIRTLRVMTTTSHQTQGDPTAALLTPRLRVSTNLQPYSPRIYNGNAYIQIHEQWRDSI
RRLEQMAQFMGLNFNEINLITYLIQHQLIQTRRNNKMTDFTKRYSSLQLNKNQDPLKYLN
EVQRKMSFNMNANNVINQKKVENSSVCGLCHAILQDPMQCNKCKTNFHKSCLLIFCKETG
KCPMNCENPKFKSLQKKRYQLIKMPLSIMKFANISQLSVKGSKILHQLVDEKALISDCVQ
NEIYRKNTFARKILDLQRESEVKLSNLLKVLEFDESKIQNNQAGDDVDRVESQIWTDSRD
YVQSIDQYCSHEISDRVIQQVLPKVPIELREEFKKAQEVLTEAKLFIKNRQFKKESINSK
QCRKNFDDIFDSLRVIADLPLDTQIFHITQKRFLNVEARDFVIFQKIQKVTPYEYFIVHK
SVSADTLNYLSQNDKLSRENTENELIHCQINISGFRLKYMTKNRTQVTYFSEMDLKLSKF
IQQKVCYKYTDIPKKLKLYMESQTNHTKKSKIQDKDTTDQEYFEESHSEDENQEINEQQA
LMREQLEKNKKELKELKREIQKIKIKMSDLPEDQRNDMLDSILIQKDSVANDYRFLNKVI
DKINVGTYDKKKLQENLKFISDLNQFNLKTNLIKGGRSYRDNTQKVANLESIISRSIQAQ
SQTSRNRNETLQLKSEIQTENTRNSNSILDIIDEKNETINQIRQKELLMKIKASMQDQMQ
KLKVRKERNKSYGQVQDRISTGRQSMQSKQDSQTVEKDEYGWPIKSHESRQMTSVSGSMV
AFQRGMLSQLKRKQLEMNLLKSQLKRSNDIQKVKDQNYIENQNRFGSLHTSLLDSESSIT
KNEIKIQEDFIHIENPVNELDFNESRINPAEVIIQEAILQDKDPQQERNWNEKKFTQQQP
KQTETQNYCFMKSPPSHMMSKFFKGLKTSRSTQNLKLKEKDKKQKNQMSSNLPDISKHIE
LKNINYESNLSGQKLIYLQNHLAQAAIPSIFMKKSHSRKQLFSNLAPAIQFSKQNHQKFV
KNALKYNQGTLAKVSSEEFLQAFRTLQNTPQQNPKIEQIFSNQIHEVPTTAYTDTFQQQL
LHSDMPEQEYLSAKKQTKNQSIGMLKKKSSSTMIPMPMTTRTFSPPFDPNLFHNKKLQEI
GTGITNSRNYGQNSSTLNNVTKKQSSLENKINI