Identifiers and Description

Gene Model Identifier

Contig17974.0.g33

Standard Name

PHD24

Aliases

Contig17974_0_g33

Description

Prokaryotic RING finger family 1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam14446 ) Prokaryotic RING finger family 1
  • ( pfam00628 ) PHD-finger
  • ( pfam00130 ) Phorbol esters/diacylglycerol binding domain (C1 domain)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17974.0.g33(coding)
ATGAGCGAAAAATAAGACTAAAGCTACGGATCACAATCATACTCAGAACATTCGGAGAGA
AACTCCTTAAATATTTAAAGTGCTCAAGAATAAGCATCTAAACACAATCCAGAGGTTTAA
AGCGCCCACTTATAGAATAAAGATGATAAAAATTCAAATAATATCAATAAATCATAGTCG
ATACTTGAGGTAAATATTGACGAAGAAGATAGCAAATAGCAGTAATACGACGATTAAAAT
CAATAATAAGACATTGAATCAGACAGAGAAAATTCACAAATTGACTAAGAGGAGTAATCA
GACGAAGATATGTAATAGCAGAATAACTTATCCAACTCAAAGCAGCAATAGAGCTAAAAT
CATGCTGGAAATCATAATAATGGCGGTAATATGCGAGAATATATGGGTCAATCTGTAAAT
AATTTGATATATCCACCACCTTACGCTTCAAGTTTGTATCAATCAGCTATGTACCCACCT
CCAAGGTTATTTTAAACTGGATTTCCAGGAGGTCAACAACCTAATCCATCATAGATGTAG
GGTGCTGGATATTATCCACCATATGCTGCTCCCGCCAATTTTTAGCACCCTGGTTTTTAT
CCACCACCACATCTTTAAGAAAGAATGTATCCACCTCCATAAGCTCAATTATAGCAGTCT
TACCAAGCACAGATGTTTGGATCTGCAGCTATGAGCCATTAATAATAACACCCAGCAAGA
ATGGGCTCATTTGCATCTGGAGGGGGTGATTTAAGTAATTCAATTACAGAAAAGAATTAA
CTTACAGACTCTAACAGATAACCAATAGTAACTCCTAGCAATATCTACCCTCCTCCATTT
GCCAGAGCCCCTGGATCTTATCAATACCCATTCCATTAAACTTAAATTATTGTGCCTAAT
TCTGAAGTTTGTGGTATGTGTGAGAAGCCTGGTGCAAGCATTCAATGCGCATCTGAATGT
AAGAAGTTTTATCACAAGGAATGTACTGAAAAGATGGCAATCAAGACTGTTATCCCATAA
GAAAGTACCGCCAAAGACACTGACTCTTAAAAAGCTGAGATTCCAGGACCCTCTAACAAT
GGCTCTCCTTAATTCTAAATTCATTGTGAGAACTGTTTGACCAGAATTTAAAAATGTTAA
CATTGTTAATAGCAAGGCTAAATTGGTCTATCTATGATTAAATGTGCTGTAGCTAAAGAG
AGAGAATCATTACCTGATAATGTCAAAGAATAATTAAAATCCCCAGTCTTTATCTGCGGA
GGTCATCATTGCCATGGCTGCTCTGAACCATTTAGAACTGATGATAGTATAATAAGATGT
TTGAAATGCGTTGCCGCTTATCATGAAAAATGCAAGGAAGCAGCAATGACAAAAATATAG
TAAATCACACAGAAGCAATTCATCTGTACTCAACATAACTTAAAAGAAATAGGCTAGAAA
TCAATAGTTTATGAGACAACAGTTGGTGAAAAAATTGGCAACGAGAGATTAGGACCATAG
CAACCTCATCATTAAGATCAAGTATAAACAGGTTTGGAGGAAGACAATTAAAAACAAGAG
GAGCCTAAGGAAAACTAGTCTTCTGTAAGCTACTAAAAAATGAGAACCAATCTGAGCAGC
ATTTTGGAATCTGGAGAATTGATGTAAGTGTAAAGGTAATCCGAGCAAGCCAATCTTAGC
ACTTAAGTTTTCAAAAATACAATGCAAGGTCCACCATAGGGACCTCCTCTATCAACCCAA
AGTTTAGGTGTTTGGAAGAAGCTTGACCCAAGCGAGACAATAGTATTGAATCAAAACACC
CTCTAAAAAGTAAACGATTTGCTTTCTTATGAAATTGAGAAACGTCAAAAGTAGCACAGT
GAAACTTAACGGAAAGAAGCTGAGGATAAGGATCGTGAGTAATTATTGGCTAAAAGACAG
AGAATAGAAATGGAAATGGAAGATGAAGACGATTATGGAGATGAGGAATAAGAAGAAAAT
AAAGAAGAAAAACAACTTGAAGAAATTAATACAAAAATTGCCGAAGACAAACCAGAAACT
AAGAAGCCAATAAACTTATCGAAAATATTAAAGAAATGCAGTTAAATTGATAGCATAATC
AAAAGACAAAAAGTATAACAAGAGAAGAAATTTGAGAAATTCTTAAAATATGCAATGGGT
GGCATGGACTCCAACATTAGGGTTCATATGTTCGAATGA


>Contig17974.0.g33(protein)
MSEKQDQSYGSQSYSEHSERNSLNIQSAQEQASKHNPEVQSAHLQNKDDKNSNNINKSQS
ILEVNIDEEDSKQQQYDDQNQQQDIESDRENSQIDQEEQSDEDMQQQNNLSNSKQQQSQN
HAGNHNNGGNMREYMGQSVNNLIYPPPYASSLYQSAMYPPPRLFQTGFPGGQQPNPSQMQ
GAGYYPPYAAPANFQHPGFYPPPHLQERMYPPPQAQLQQSYQAQMFGSAAMSHQQQHPAR
MGSFASGGGDLSNSITEKNQLTDSNRQPIVTPSNIYPPPFARAPGSYQYPFHQTQIIVPN
SEVCGMCEKPGASIQCASECKKFYHKECTEKMAIKTVIPQESTAKDTDSQKAEIPGPSNN
GSPQFQIHCENCLTRIQKCQHCQQQGQIGLSMIKCAVAKERESLPDNVKEQLKSPVFICG
GHHCHGCSEPFRTDDSIIRCLKCVAAYHEKCKEAAMTKIQQITQKQFICTQHNLKEIGQK
SIVYETTVGEKIGNERLGPQQPHHQDQVQTGLEEDNQKQEEPKENQSSVSYQKMRTNLSS
ILESGELMQVQRQSEQANLSTQVFKNTMQGPPQGPPLSTQSLGVWKKLDPSETIVLNQNT
LQKVNDLLSYEIEKRQKQHSETQRKEAEDKDREQLLAKRQRIEMEMEDEDDYGDEEQEEN
KEEKQLEEINTKIAEDKPETKKPINLSKILKKCSQIDSIIKRQKVQQEKKFEKFLKYAMG
GMDSNIRVHMFE