Identifiers and Description

Gene Model Identifier

Contig11035.0.g68

Standard Name

PHD21

Aliases

Contig11035_0_g68

Description

PHD-zinc-finger like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam13832 ) PHD-zinc-finger like domain
  • ( pfam13771 ) PHD-like zinc-binding domain
  • ( pfam00628 ) PHD-finger
  • ( pfam00130 ) Phorbol esters/diacylglycerol binding domain (C1 domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003168600.0000000010002658722841845hypothetical protein
SGDYPR031W0.000000007002490258088747NTO1 SGDID:S000006235, Chr XVI
from 631515-633761, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11035.0.g68(coding)
ATGGACACAAAGCATTTCTTACAATCACTTCAAGAATCATTATCATAGTTCCATCAGCAG
CATGATCACACTTCCAAACAAAGACTTTCTCAGAATCATATAGTCCCTGGTGGCAGCTAA
AACAGTTTAATCACTCTAGAGCCTGTAGCTCCTATCATACCATTTATCAATGTGAGCAAC
AATTTAGCCACTTAATTCAGTAGTATTAAACCTATGATGACAGACTACAATAGCCTCATA
AACGATAATGGTAACTTTAATCGAAATAATGGAAACACTAATTATCAACAGCAGCCCCCT
GGGTATGGTAGTGCTATGAATAACTCTAACAGAAATAACTCAATGCTGAATAATTTCTCA
ATAATAAACAACAATAACAATGATAGATCCAATCTTTCAATCAATTTTAACTAAAATTCG
ACTCTTACAAACAACCCTTTCTCTATGTTTGATAATTCAGCTGTGAAAGCTTAAGGAGCA
GGAAACTCAAAACTTAATTAGGATTTAGACTCACTTTTTGCCAAATAATCTCATTAGTTA
AGCGTGAATAAAGAAGAGTATTCCACCATGTCAAATAATTACCATGAAAAACTCTCGTCA
ACTTTAATACCTCAAGTAACTGATCCTAGACTGCAAAAATAACTAGAACTTGCATAATAA
ATGTTTAATGAGGAAAAAGAATAGGAGAGATCTTAATATTGTTAGATGGGAACTAGCAAC
CCAAAAAGTATGCTTAGTTGCTAAGCAAATGAAAATTCTCAAAGCTAATGCTCAAATATA
AATGGTGGATAAAGATCAAAAATAAATGCCATAAATATTGATCTTAACCGCTTGTAGCAG
AAAGATGAAATGGAAAGTCATCTATCTCAAATTTAAGTTATGCAAAATGATACTGATTAA
CAAGAATTAGCTAGAAAGACAGCTTTATATCAGAAAATGTAATATAAAGAGGCACTTGAA
TCAGAAATATTAGAAGATCCAAGAACTGCAAATGCTTACAATGAATATGCCCCGATAACT
AATGTTGTATTAGGTACTGGATTCCTTATAAATTACGATGAGGTTAGAGCAAAATACGAT
AAAGTAATAAACACTTCAAACAATCCGGCTGCTGGGGATTTGTAGTGTGATTGTTGTCTC
TCAAGAGTCTCGTACACTGATAATAAACTTGTTTATTGTGAACTTTGCTACTCAGCTATT
CATGTAAAATGTCATGGTAGAAAATTATTATACTCTTCTTAAGGTGGCACTATACCGTTT
GACACTTTCCTGTGTGAAAGATGTAAATACTATGTGGATAATGATTTTGAGAATTATGAG
TAGATTAAGTGCAAATTTTGTGATGAACTAAAAGGCATATTGATCTACATAGACAGAAAT
TAAAAGAAAAATGTTTTAGTTGGATGGATTCATCTGGCATGTATCTTTTGGCATTCTAGT
ATAAAATTCTCTGATGAATCTCGAATGGATGTCATGCAAGTTTAGAGGAATTATCAATCA
AGAAATAAATGCTGCTATTGTCGTAATACGGCTTAAAGCAAGAAAACTATGACTTGTGAA
TTTAATTGCAAGAAAACTTTTCATGTCAGATGTGCTATCTAGAGAGGCTTAATAACAGAT
TACGAAATAATGAGGGAAAAATAAGCAAACAAAATGACTGGAGAACCTTAAGTATACTGC
TCTAAGCATACAAGGCTTTTCAGAGAACTTTCTGACAATCCAGATATGCAATCATTTTTG
ACAGAGTTTAATTCAACAATAGGTTCAGATGAAGAAGAAAGAACTGAAAATTCAAATATT
TTATCTATAAATCCAGAAGAGGATACATTTGAACATTTTGATAAGCCAGAAGATTTTCAT
AGAAATGAGCCAAATGAATAAGCAAGTGTATTCTAATAATTGACTCACAATGATGTTACT
TCATTCATTATGGAAAATGAACATTAGAATAAAAAATTAAATAAAATGTAAGGTTTTGGA
AATGGTGGCTAAAATTCAGTCATTGAGATTGGGAGCTCACAAAGATAAAGTTAGACTACA
AGGGGTAGAAGAGGCAAAAAGCAAGCAATTCACTTAAACTTAGATGATCCAAACCCTCTA
TCTTCATTTGAGAATTTTGGGACAAATTAAGAACCTTCAATTATGAGTCTGCTGCCCATG
AATGAAGCACCTTCCTACATGAACTAATATTAGGCTTAGCAATATTTACAATCTTAGAAA
GATACCTAATATTTTCAACAACAGAGAAAGAGAGGACCTAAACCAAGATAAATTGCTGGG
CCAAACTAACTCTCAGATAAATTAGTAGCTTAAAGAATGGACGAAGTATCATACTTTGAA
TAGATTATCGAACATCAAAACCAAGATAGAATGGAAGCTCTTGAATAGTACCCAGATTAA
ACGAAATATTACTTTCACAGAGAGCATAGAGAAACCAAAAGAAGAGGTAGAATGTCCTTT
AAAGAGAAGATCTAAATGATGCATGACTAATAATTAGATCGAAGCACTTGCGTAAATAAC
GAATTCTCACAGATGAGTGTTGAAAATCCATCATCAACTTACATAGCAAATAATGCAGCA
CCTACTGACATTATGGAAGTCAAGCAATATATGTAAGTGAGGCCAGAATTAAGACAAGAT
TTCGGTTTAAGGTTAAGAATGAATGCGGGTGAGAATATAATGTATGATGTTAGACCAGAG
CTTCAGACTCTCTTTAAACTTAAATCCCCATGCTCCAGAAGAGATGTGCTGACTGCTTTT
GTTGGATTTTGTAATGATAATGATTTAGTAGATCTACAATGTCATCATTACAACATATCA
AGGCATCCAAAGTTAAGAGCTATGTTGGGAGTTGATGTTATGGAATCAAGGGAAATATTT
AAATATTTGAAGGGACTAGTCAATCCCTTCTCTGTTGAGGAAAGAGAAGCATAGAGGAAA
ACGCTGGTTGAAATGAAATTCAGAAATCAACTTGCTATTAACAACCAAAATATGAGCGAG
GACTTTAGTAATAATCAAGGAGTCATTGATGATTTCTCATTTAGAGTATGA


>Contig11035.0.g68(protein)
MDTKHFLQSLQESLSQFHQQHDHTSKQRLSQNHIVPGGSQNSLITLEPVAPIIPFINVSN
NLATQFSSIKPMMTDYNSLINDNGNFNRNNGNTNYQQQPPGYGSAMNNSNRNNSMLNNFS
IINNNNNDRSNLSINFNQNSTLTNNPFSMFDNSAVKAQGAGNSKLNQDLDSLFAKQSHQL
SVNKEEYSTMSNNYHEKLSSTLIPQVTDPRLQKQLELAQQMFNEEKEQERSQYCQMGTSN
PKSMLSCQANENSQSQCSNINGGQRSKINAINIDLNRLQQKDEMESHLSQIQVMQNDTDQ
QELARKTALYQKMQYKEALESEILEDPRTANAYNEYAPITNVVLGTGFLINYDEVRAKYD
KVINTSNNPAAGDLQCDCCLSRVSYTDNKLVYCELCYSAIHVKCHGRKLLYSSQGGTIPF
DTFLCERCKYYVDNDFENYEQIKCKFCDELKGILIYIDRNQKKNVLVGWIHLACIFWHSS
IKFSDESRMDVMQVQRNYQSRNKCCYCRNTAQSKKTMTCEFNCKKTFHVRCAIQRGLITD
YEIMREKQANKMTGEPQVYCSKHTRLFRELSDNPDMQSFLTEFNSTIGSDEEERTENSNI
LSINPEEDTFEHFDKPEDFHRNEPNEQASVFQQLTHNDVTSFIMENEHQNKKLNKMQGFG
NGGQNSVIEIGSSQRQSQTTRGRRGKKQAIHLNLDDPNPLSSFENFGTNQEPSIMSLLPM
NEAPSYMNQYQAQQYLQSQKDTQYFQQQRKRGPKPRQIAGPNQLSDKLVAQRMDEVSYFE
QIIEHQNQDRMEALEQYPDQTKYYFHREHRETKRRGRMSFKEKIQMMHDQQLDRSTCVNN
EFSQMSVENPSSTYIANNAAPTDIMEVKQYMQVRPELRQDFGLRLRMNAGENIMYDVRPE
LQTLFKLKSPCSRRDVLTAFVGFCNDNDLVDLQCHHYNISRHPKLRAMLGVDVMESREIF
KYLKGLVNPFSVEEREAQRKTLVEMKFRNQLAINNQNMSEDFSNNQGVIDDFSFRV