Identifiers and Description

Gene Model Identifier

Contig1194.0.g9

Standard Name

PHD20

Aliases

Contig1194_0_g9

Description

PLU-1-like protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • protein binding (IEA) | GO:0005515
  • oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors (IEA) | GO:0016706

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003244802.0004286606204839e-16PHD-finger family protein
SGDYMR176W0.0000020007268868677913ECM5 SGDID:S000004788, Chr XII
I from 611740-615975, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1194.0.g9(coding)
ATGAATTAAGACGAACCCAAGTCATAGACTAGCGCAGTGAACTCGAATGTTCAAAGCGCA
CACAACAGCAACTAAAAGAAGTCAAAGCGCGGGGGTTATAGGGGCCGCAACACCCAAAAC
CCCTTAACAGATTAAAATTTCCGCTCATAAAACTCTAAGGAAGCCTAGGATTACAGGACT
TTAAGCAATGAATAATTTGAGGCATTGAAGGAACAGTATTAAAATGTTGATGGAGCATGT
GATTGGTTCACTATGAAGAAATAAGAACTGGAGAAAGGAGGGTCTAATGGGCAGTAGTCA
TCTAGTTTAAAGAAAAATAATGGAGTAAATTTGCATATCAATCACTTGCCTATCTATCAT
TAATGGAGGCCACCCAGAATAGATTAAGTTAAGTATTAAGTGGATGGGCAAAACATACCA
GAAAATTCGCATCAAGTAGCTTAAAACTAATCTCCAAAACAAATCTAATAAGATTTAGCT
GATAGTAAAGTTATCGGTGATTTAGAAGAAGGAAAATAATAGTAATAAGTAGTGAGTGTC
AAAATAAACATAGATAGTAAGATTCTAGGTAAAAAGAGAATAGTGAGATCCTCATCTTTT
GATTTAGATGAAGTCAAGGATTTTGTGCCAAGGAGAAAAGTTATATTTGATGGAGAGCCT
CTTATTCAAGATTTAGATGAATAGAAGAAAAAAGAAAGCCAAATTATAAAAGATTCATAG
GTAAAAACTTCAGAGAAAGAGAATGAGAAAGATAGAACTCATGAGAAAATTGTTTATGAT
ACAAGAGATCCATTGAACAATGACCTTAAATTGACTGATTACCTTGAGCTTTGCGATTTT
ATCATGAAAGAGACTCATAATACAAACTGTAATGGATTGTGGCTTAAGGGCTCACTGGCT
GGTTATCAAGAGAAAGCAATGAAGCTACTCCATGAGTACAATTACAACTATAACCTAGCA
AAATTTCACATTCTCTATCCAACTGTAATGGCGATACCTGAGTAAAGAGAGGAAATACTT
AACTCATTGACAGAACAAGAATTAGAGTCGATAGTGAACGATGCAGTTATAGATCTTCGC
GGTTGTAAAAGCATTGAAGCAGAAGATGCGATAAGTAATATTAGAAATGATATGAGAACT
AATCGCATCACTGTGGAGGAGCTAGGTCACTATTAACAGATGTTAAAGAAGTTAAGAGTA
GAGATGCCTTCCGATATCGAATAAGAATTTGCTAGAGGTAGAGACTTCTCGAAATTAATT
AAGAAAAAATGTGGCCCTTAAACAGGAGGAGGAGCTGCAGCCCAGATACCCTATGAGAAA
AAGATGAAACTTTCTGAAATCACAAATATGTATAACGAGTCCTTAGAATATCAAATTATC
ACACCTGAAATGCAGTAGCTATCTGAGTATCTGAAGAAATCATAATAATGGATTGAGAAA
GCTGAGTAGCTTAAAAACCAAGTGGTTAATGTTAAATAACTACAAAACATTCTCGCTGAA
TCTAGAAGCATCCCAGTAAATTTTGAAGGTCTTTTTGAGGAGCTGAGAAAGCGTTCAATA
GATTCCTCCAATCTTGTTGAGAAAATTCACTAAGCTTTCATCAAGGTTAATAAAACAAGA
ACTTAGGTCAACTAAGAATAATAGAATACCTCAACTTCTAAAGAGAGAAAGAAGTTGCAA
GATTAGTAAAAGAAAGAGAAATAGAAAAAAGAATAGCAATTTAAGGATTTACTTGGTGAA
GCTGATATCTTAATGATAACAAATCCTGAGATACAAAAATTAAGGGAGCATGTTGATGAC
ATTGAAAGATGGAAATGCAGAGTCTTAATGTTCTTAGAGGACGAATCAGAGCAGAAGAAC
AGAAAAGAGGTCTTTAATCAATTGATCAAAGAGACAGCACTATTCAAATACGATGTTGAT
TTGACTGAAGATCTATAAAGAAGATTAGAGTTTTTAGAATGGTTTGAGAAAGTAGAGAAG
GTTTATAATTAACTTGGTCTTCCAAGTAAATAAGCTTCTCCCTTATCATCAGTATAGCAA
TCTTAAGCCTATGTAGAAGAAGAAAAGAAGGAAATTGAGCATATCGATACAGTTATGAAG
GAGGAATATTATACATAAAAGATCATAGAAGACTAGTAAGCGGTATAAAAAGTTCCTCTA
AGTTAGATATAATCTATTATGCAAGAAGGAGAAAGCAAAGGTTTTTCAGATATATAACTC
GAAAAAATCATCAAAGTTGGAGAAATTTGCTTGAAAGCAAACTTATTCGAGACTAAACTT
AGCAAAATATTAAAGGACATAAAAGACATATCTAGCAGCAGTAAAGACATCAAGCCCAAA
GTAGATATGAGTAAACTAATCGAGTTAAAGGAGGAAAGCGAAAATTTGAGAGTATATATT
GAAGAGATGAATGAGCTCGATGAAATTATTTAAGAAGTTAAAGATTACGAGCTCAAATGC
TAAGAATTTATAGACAAGTCCAAATTTTTGAATGAAGATATCATGGAAATTGATCAAGTT
CAACAAAACGAATAATCTCTTTAAAATCCAAGAGAATTTTTGAAGCAAATCCTTCAGCTT
AGATTAAGCATCACGAAACTTGGAGTTAAAAATAAGACTTTTAAGGTTTTTAAGCGAATC
ATCAAGCCTCTTCTAAGATGGATTAGACTCTCAAGATTAATTATTAAAAACTATCATAAG
AGCTTAAGTTCAGAAGTTGCCTCTTCCTTTTCTCAGCTTAATCTTCTTGATTAGTAAGAC
TACGAAAGCGAATCATCCTCTGATGAGTTGTTAGACGAAGAGATCATAAATACTGAAAGT
ACTTATAATAACTCAACTTAATGCAAATTCATAAGCAAGCTAGAGTAATAATACGACTTA
TTGAACGCATTACTTGCATAAGCAGACTAATCTTTCAAGCTTTTACAGAAAACTAGCGAT
TACTCCATACTTACTAAAATCAAGGGGAAGGTTGACAATTGGTTGAGTAAGCAAATACAA
ATTGAAGAGGAACGAAATAAGTTTAATAAAGATATAGTGATTGATGAGGAGATACAAAAG
CCAATTGTTTCAGAGAATAATCAATAAATCATTGAATAATTGGAAGAACTTGATAATGAG
CACTTGCCAGTGCCAACTGAATATAAGCAAAGAGTCTAGAAAGTATTGAGAAGAGAGAAA
TGGCTGAGAAAACTTAAGGATTTATATCAAAATGAAAGAGTTAAGATAAAGCAGGTTGAA
TCTCTTGTTAAAGACTCAAATCACAATGACATACAAGAAGATGTAAAATGCAAAGCTCTC
TCTGATTTACTCAAGACTCAACTTTAAACTTGCAGAGACTGGCTTTAAGTCTAATCCTCC
GCTGATTTAACACTCCAGAAAGATATCATGAAACTACTAGATCAAGGAAAGAAGCATTTA
AAACTCAACCTCACTGATTACGTAGACTTGAGAAACTTCCATCAAGATGTTCTGGAGTGG
AAGGAAAAGACTTAATAAATCTTGGAAAATGGAATAGGAAAGCAAAGAATTTAAAATGTT
AAACCAGAGGCAGAGGGAGGAGAAAACTATGAAAGTGTCAGAAAACACATAGATATGGGT
GTTGGTCAATTAGACATCCAAGATAAAGAAATTGACGTGTTAAAGAGTATTGTTGAAATG
AGCGCTCATTGGAAGAGTATTGCCAGAAAGATACTAAAAAGCAGGGAGTTATGTTAATTA
AAACATAAAAACATCATCGTTAAAGATGTGTTTGGTTTAGCTCAAATTGTTGATAATCTA
GAAGAGACAAAACAAGACAATTAGTAGTCTAACACAGATCAATCTCTTCAACTTAAGTAA
TTAATGGCAGCTAATGATAAACCAATGAATTCTTTGAAACCTTTTGTACCAAATACATAT
AAAAAGCCGATAACTCTTTACGAGTACTTCGATAATCAGCAATATTGTATCTGCCGAAGA
GGTGACGACGGTTTTGCTTTTATGATTGAATGCGATTGTTGCAAAGAATGGTTCCATGGA
GATTGCGTTGGAATATCGAAGCAAGTTGGCAATAAAATTACTCAATATATTTGTGTTGGA
TGCGCTAGAGTGATCTACAACTATGATTTAGTGACTCAAGGAGTAGTTCAAAGCAAGGGA
GTTCCTTAAGGAGAAGAGTTTGATAAGCTTAGTGGAATCCAACAAGTTAGCGAATTCCAC
CTTGATATTTTCAGCGTTGCCCGCAGAGCTCAATACTAGCAACTCCAAGATTTGATATAA
GAAGGTGAAACTAACATCCCAATTTTCCTTGAGGAGATGGAAGAACTGAAGGAAGTAGAA
TATAAAGTAGAGTAATGGCTTGATAATATTTAGCCTTTCTTGAGTCAATCGCCTGTAGAG
GATTTATGCGAGGAATATAGTTAAAGTGAAAATACGGATTCTATGCTGATCAACACCTAA
ATCAATAAACAACAATAGCAGCTTTAACAAAAGTACTTCCTAGACTAGAACACGCTGTAA
ATTTTAAAGTTTTATCTTGAAAGTGAAGCCTTCCCTGTTGAACTGTCCGAGAGTGAGGAA
TTACTTTTGATTCTAAAATAACGTAGATGGTATCAGGAAGTTAGAAAAGCTGTGAATAGA
ACTGCAAGTGGACCTAAGTGGAATAAAGTACAATTCAAGAAGAATATTAAGAGGCTTATT
GGAATTGCTTAAGAGTTGAAAGTACACACTGATGAGAAACTCCTTCAAATGTATGAAGCT
CTCCAGATGCAGCTTGCTGGTTAACAACAATAACAACCCAGTACTTAATCACAGTAACAT
CAGCTTCCCAACACTCAATAGCAGTATCCGCATCAACAGCATCATTAACATAACTACCTT
CAACCAATGAGTCCCTAAATTATACCAAGTAATAATCATTAAAGCCAGCAATAGTAGAGA
GCCAAGTAGCATTAGATGTATCATAATGAACATTAACAGCAATAGATATAATCTCAGCAA
ATTCCAACATAAGCAGGCGGTAAAGTGAAATCGCATTACATTTAGAAGTTCTCTTAGAAA
CCCACTCAATAAATGAGTTAAAAAACAGGTTAAATAGCATAACAGTAAATGATAGAACAA
TCTCACAAGGTCTCACTACTTGAATAAGAATGGGACGGGCTCTTTGAAAGTAATCAGGCT
GATTATTTAGAGATTGAAGACTTTATTGATCGAGTTGAGGCTTAATGCTTGGCTTAAAGC
GAAGAAGAGATAATCAAAATGCAAGGATTGAAGAATACTCTATAAGAGTACTAGGAGTGG
TTACTATAAGTTAATGTTTTCCTAAATTCTGCAGATGCTCATATTCAAGACTATGAAAGA
CTCATTGATAAAGGGCAGAGATATTTCTACATGATACTCAGCAAAGAGAAATTCTAGTTT
GAAAGTTTACAGGATCACTACTATAGATGGTACAATAAAGCTGTAGACCTATATGGAAAT
TTTGAGAAAGCTGATCCTTAAGCTTTCTTAAACCCCAGCAACATCAAATACAACTAAGAG
TAAATTGGTTAGTTGCTGAATGAATACAAGCAAAAGGTTCCTTTTGAAAGCTTTCCACAT
GAGTGTTTAACTAAGATCTATAACGCTATAACTCAAGCAGTAGCATTAAATCTCTAGAAT
CAAGGCCAAGTTTTAAATTAACCAGATTCTCAAGATCAAGAAATGGATCTTGAATCAGAA
ATTTAACCAGAACTTATTTTAGCAGTGACTCCTTCCAAAAGCAACCCAACTCAACAGAAA
ACAATGGAAGAGGATTACTTAGATCATTAAGAAGAGCAGAAGCAAATGGACTTACCAGAA
GCCGAACAGATAGGTATAATTGAGGTTGATAACGGCATGGCGGACCCAATTTCAGTCCAA
GACTTCCATTTGAATCATGACATGTAGATTGAGGAATAAGATATTGAGAAAATGAATGCT
GACAATAAGAATGAGCTGTCCAATAATTTAATGATCCCTAAAGAAAGCATACCTGATCAT
GATGACTTCTTTAAATGA


>Contig1194.0.g9(protein)
MNQDEPKSQTSAVNSNVQSAHNSNQKKSKRGGYRGRNTQNPLTDQNFRSQNSKEAQDYRT
LSNEQFEALKEQYQNVDGACDWFTMKKQELEKGGSNGQQSSSLKKNNGVNLHINHLPIYH
QWRPPRIDQVKYQVDGQNIPENSHQVAQNQSPKQIQQDLADSKVIGDLEEGKQQQQVVSV
KINIDSKILGKKRIVRSSSFDLDEVKDFVPRRKVIFDGEPLIQDLDEQKKKESQIIKDSQ
VKTSEKENEKDRTHEKIVYDTRDPLNNDLKLTDYLELCDFIMKETHNTNCNGLWLKGSLA
GYQEKAMKLLHEYNYNYNLAKFHILYPTVMAIPEQREEILNSLTEQELESIVNDAVIDLR
GCKSIEAEDAISNIRNDMRTNRITVEELGHYQQMLKKLRVEMPSDIEQEFARGRDFSKLI
KKKCGPQTGGGAAAQIPYEKKMKLSEITNMYNESLEYQIITPEMQQLSEYLKKSQQWIEK
AEQLKNQVVNVKQLQNILAESRSIPVNFEGLFEELRKRSIDSSNLVEKIHQAFIKVNKTR
TQVNQEQQNTSTSKERKKLQDQQKKEKQKKEQQFKDLLGEADILMITNPEIQKLREHVDD
IERWKCRVLMFLEDESEQKNRKEVFNQLIKETALFKYDVDLTEDLQRRLEFLEWFEKVEK
VYNQLGLPSKQASPLSSVQQSQAYVEEEKKEIEHIDTVMKEEYYTQKIIEDQQAVQKVPL
SQIQSIMQEGESKGFSDIQLEKIIKVGEICLKANLFETKLSKILKDIKDISSSSKDIKPK
VDMSKLIELKEESENLRVYIEEMNELDEIIQEVKDYELKCQEFIDKSKFLNEDIMEIDQV
QQNEQSLQNPREFLKQILQLRLSITKLGVKNKTFKVFKRIIKPLLRWIRLSRLIIKNYHK
SLSSEVASSFSQLNLLDQQDYESESSSDELLDEEIINTESTYNNSTQCKFISKLEQQYDL
LNALLAQADQSFKLLQKTSDYSILTKIKGKVDNWLSKQIQIEEERNKFNKDIVIDEEIQK
PIVSENNQQIIEQLEELDNEHLPVPTEYKQRVQKVLRREKWLRKLKDLYQNERVKIKQVE
SLVKDSNHNDIQEDVKCKALSDLLKTQLQTCRDWLQVQSSADLTLQKDIMKLLDQGKKHL
KLNLTDYVDLRNFHQDVLEWKEKTQQILENGIGKQRIQNVKPEAEGGENYESVRKHIDMG
VGQLDIQDKEIDVLKSIVEMSAHWKSIARKILKSRELCQLKHKNIIVKDVFGLAQIVDNL
EETKQDNQQSNTDQSLQLKQLMAANDKPMNSLKPFVPNTYKKPITLYEYFDNQQYCICRR
GDDGFAFMIECDCCKEWFHGDCVGISKQVGNKITQYICVGCARVIYNYDLVTQGVVQSKG
VPQGEEFDKLSGIQQVSEFHLDIFSVARRAQYQQLQDLIQEGETNIPIFLEEMEELKEVE
YKVEQWLDNIQPFLSQSPVEDLCEEYSQSENTDSMLINTQINKQQQQLQQKYFLDQNTLQ
ILKFYLESEAFPVELSESEELLLILKQRRWYQEVRKAVNRTASGPKWNKVQFKKNIKRLI
GIAQELKVHTDEKLLQMYEALQMQLAGQQQQQPSTQSQQHQLPNTQQQYPHQQHHQHNYL
QPMSPQIIPSNNHQSQQQQRAKQHQMYHNEHQQQQIQSQQIPTQAGGKVKSHYIQKFSQK
PTQQMSQKTGQIAQQQMIEQSHKVSLLEQEWDGLFESNQADYLEIEDFIDRVEAQCLAQS
EEEIIKMQGLKNTLQEYQEWLLQVNVFLNSADAHIQDYERLIDKGQRYFYMILSKEKFQF
ESLQDHYYRWYNKAVDLYGNFEKADPQAFLNPSNIKYNQEQIGQLLNEYKQKVPFESFPH
ECLTKIYNAITQAVALNLQNQGQVLNQPDSQDQEMDLESEIQPELILAVTPSKSNPTQQK
TMEEDYLDHQEEQKQMDLPEAEQIGIIEVDNGMADPISVQDFHLNHDMQIEEQDIEKMNA
DNKNELSNNLMIPKESIPDHDDFFK