Identifiers and Description

Gene Model Identifier

Contig15575.0.g12

Standard Name

PHD18

Aliases

Contig15575_0_g12

Description

PHD-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003484900.00000019998969434520019MIZ zinc finger family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15575.0.g12(coding)
ATGCAGTCTATGAAGAATTTGAGAATCAAACTAAAGAGCAGTAAATCCAAAAGCATTGTC
AAGAGAGTATTGGGATTATTGTAATTTTAACCTAATGGAATTAGTTAGCAGCCCATTCCG
TAGCAACCTATGACAGCATTATAAACCAGGATGCAAGAAATTTAAGCTTAAATATAAGCT
AAAAATTAGAAAATACTAATAAGCATTGATGAAGAGGAGGAAGATGAATTTGATAATTTA
GAGTTTGCAGATGACAAGCCAAAAGCCAATCAGGATGAAAATTAACAGCAAGAAAATAAT
ATGTAAATGGAGATTTATAAAGGGCCTCCAAATGCAAATAAACAGTAAGATTCAAAGGAA
TAAGAGGAATAGAAAATATATGAATAGTATATATAATTCAGAAAATAGCAAGCTGTTGCT
CCTTAAAGTCATGTAAAAACCATTTAACAGTTGCAACAAATACAAACAAACAATACCTAA
TAAATTGTTACCTAAAATACTTAGGCTTCAAATTAAGGATAGCTGATTCCATAACCAAAT
TAACAGCAATAAAAATAGGGATATGACCCAGTTTATGAAGAAAATCAGAGAAAACACAAA
GAAATGATGGCTTATGATAAAAAGCTTTAGAAATTAGTTTTAGTTCCAAAACAGTCTATT
TTCACTATACTTCCTCAGTTCAAAGAAAGGCTTCATTAAATAACTTTCAACGATATAATG
CAGGATGTATATACCCCTACTATTGCAGATCATAACTCAGAGTCAAATGAGATCCAATGT
ATTTGCTGGCAGGATGAGCAATATAAGCACTCAAGAAGAGTGCTAATTGAATGCACAAGA
TGCCACAAAAAATAGCATAGAAAATGCTTGGGAAATAAAGGGGAACTCATAATCCCTTAT
ATTTGCCCTCATTGCTAATTGATCCAATTAGACTAAATAAGGCAGCCAGTTTTGACATTA
GTCAGGCCTTTTAAAGTCCCTAAAATTGCTGGAAATAATGCTATGAAGCAAAAACTCATG
ATGTTTTGCAAAAAAGAGTTTGAGATTGATGAAAGATTCGAAAGATACCTTTTATAAAAA
CATGAAGTCCTATTTATTGAGATCAGATGTGTGAGGCTTGATGCTTTTGAAAATAGAGAC
AAAGCAAAGAGAGGAAATTTTAAATAGTAGTGGCCAAATAAAGGTTGGTTCAGTTTCAAC
TATAGACATGGCAGAGAATTTGTGATCCCTCATAATTTAAACACTGCCTAGAATCCAGTT
GACGATTTGACTTTGGCTGGAATTGGAGTTGAACGAGCTCGAAGAGATGAAGACATATTT
GATGTTTCAGCTGAAGTAAAGGTTAACACGAACTTTGTAGAGATATCTTAATTTGATGAT
GACCATACTTATGCCTGTGCTGTCTACGTTACTAAAAGAGTTAACATCCCAGACATTTAT
AAGCACATTAGATGCAATAAAATGAACTCAATTTTTGAAAGCTATGAAAATCTCAAACGT
CGAGTTTACTTGAACGAATATTTCTGGAAGGAAACTATCAATCTTAGATGCCCAATTTCA
AATTCAAGAATCAAATTACCAGCATGA


>Contig15575.0.g12(protein)
MQSMKNLRIKLKSSKSKSIVKRVLGLLQFQPNGISQQPIPQQPMTALQTRMQEIQAQIQA
KNQKILISIDEEEEDEFDNLEFADDKPKANQDENQQQENNMQMEIYKGPPNANKQQDSKE
QEEQKIYEQYIQFRKQQAVAPQSHVKTIQQLQQIQTNNTQQIVTQNTQASNQGQLIPQPN
QQQQKQGYDPVYEENQRKHKEMMAYDKKLQKLVLVPKQSIFTILPQFKERLHQITFNDIM
QDVYTPTIADHNSESNEIQCICWQDEQYKHSRRVLIECTRCHKKQHRKCLGNKGELIIPY
ICPHCQLIQLDQIRQPVLTLVRPFKVPKIAGNNAMKQKLMMFCKKEFEIDERFERYLLQK
HEVLFIEIRCVRLDAFENRDKAKRGNFKQQWPNKGWFSFNYRHGREFVIPHNLNTAQNPV
DDLTLAGIGVERARRDEDIFDVSAEVKVNTNFVEISQFDDDHTYACAVYVTKRVNIPDIY
KHIRCNKMNSIFESYENLKRRVYLNEYFWKETINLRCPISNSRIKLPA