Identifiers and Description

Gene Model Identifier

Contig1555.0.g6

Standard Name

PHD17

Aliases

Contig1555_0_g6

Description

PHD-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004422700.00000019998969434520019MIZ zinc finger family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1555.0.g6(coding)
ATGCAGTCTATGAAGAATTTGAGAATCAAACTAAAGAGCAGTAAATCCAAAAGCATTGTC
AAGAGAGTATTGGGATTATTGTAATTTTAACCTAATGGAATTAGTTAGCAGCCCATTCCG
TAGCAACCTATGACAGCATTATAAACCAGGATGCAAGAAATTTAAGCTTAAATATAAGCT
AAAAATTAGAAAATACTAATAAGCATTGATGAAGAGGAGGAAGATGAATTTGATAATTTA
GAGTTTGCAGATGACAAGCCAAAAGCCAATCAGGATGAAAATTAACAGCAAGAAAATAAT
ATGTAAATGGAGATTTATAAAGGGCCTCCAAATGCAAATAAACAGTAAGATTCAAAGGAA
TAAGAGGAATAGAAAATATATGAATAGTATATATAATTCAGAAAATAGCAAGCTGTTGCT
CCTTAAAGTCATGTAAAAACCATTTAACAGTTGCAACAAATACAAACAAACAATACCTAA
TAAATTGTTACCTAAAATACTTAGGCTTCAAATTAAGGATAGCTGATTCCATAACCAAAT
TAACAGCAATAAAAATAGGGATATGACCCAGTTTATGAAGAAAATCAGAGAAAACACAAA
GAAATGATGGCATATGATAAAAAGCTATCATAATCAGAGTCAAATGAGATCCAATGTATT
TGCTGGCAGGATGAGCAATATAAGCACTCAAGAAGAGTGCTAATTGAATGCACAAGATGC
CACAAAAAATAGCATAGAAAATGCTTGGGAAATAAAGGGGAACTCATAATCCCTTATATT
TGCCCTCATTGCTAATTGATCCAATTAGACTAAATAAGGCAGCCAGTTTTGACATTAGTC
AGGCCTTTTAAAGTCCCTAAAATTGCTGGAAATAATGCTATGAAGCAAAAACTCATGATG
TTTTGCAAAAAAGAGTTTGAGATTGATGAAAGATTCGAAAGATACCTTTTATAAAAACAT
GAAGTCCTATTTATTGAGATCAGATGTGTGAGGCTTGATGCTTTTGAAAATAGAGACAAG
GCAAAGAGAGAAAATTTTAAATAGTAGTGGCCAAATAAAGGTTGGTTCAGTTTCAACTAT
AGACATGGCAGAGAATTTGTGATCCCTCATAATTTAAACACTGCCTAGAATCCAGTTGAC
GATTTGACTTTGGCTGGAATTGGAGTTGAACGAGCTCGAAGAGATGAAGACATATTTGAT
GTTTCAGCTGAAGTAAAGGTTAACACAAACTTTGTAGAGATATCTTAATTTGATGATGAC
CACACTTATGCCTGTGCTGTCTACGTTACTAAAAGAGTTAACATCCCAGACATTTATAAG
CACATTAGATGTAATAAAATGAACTCAATTTTTGAAAGCTATGAGAATCTCAAACGTCGA
GTTTACTTGAACGAATATTTCTGGAAGGAAACTATCAATCTTAGATGCCCAATTTCAAAT
TCAAGAATCAAGTTTATGCAGCTTATAATTGAATAAGTTAATATTTTGTACCCACTAGAT
TTCAATCTTAATATCTTGCCAAGACCAGAGGTTATTAAGATTCTTTAAAGAGAAATAAAT
TCAGGGGAAACTGAATACAAAGACATAGATAAGAATGATTTAAAGACTTGTACATTAGAA
AGCGATTTAAGTGTAAAGATTGGCTGCAGAACATTTATTTTGGATGATACTCAAGAACCA
AATTAAATGATTGAATTTCGTGCTGACGATCCAAAATCAATGAAAATCTCGAAAACAAAC
CTCTGTGTATTAGGCTAATTCCGCAAAGATTACAGATAGAAATAAAGAAACGACCTCAAA
CGAGGTTTCAGTCTCCCTTCTAGAAGTTAATCTCAATTCTCTTAGATTTCATAATCCCAA
AGTTTATACTTATCCCCCTCTCAGCTTTTGCCTCAGAAAGATTAGTAAGACTATATACTC
AGTGAAATGAGCAAAATGCCCGAATATTAAAAAGAAGAGAAAGAAAAATGA


>Contig1555.0.g6(protein)
MQSMKNLRIKLKSSKSKSIVKRVLGLLQFQPNGISQQPIPQQPMTALQTRMQEIQAQIQA
KNQKILISIDEEEEDEFDNLEFADDKPKANQDENQQQENNMQMEIYKGPPNANKQQDSKE
QEEQKIYEQYIQFRKQQAVAPQSHVKTIQQLQQIQTNNTQQIVTQNTQASNQGQLIPQPN
QQQQKQGYDPVYEENQRKHKEMMAYDKKLSQSESNEIQCICWQDEQYKHSRRVLIECTRC
HKKQHRKCLGNKGELIIPYICPHCQLIQLDQIRQPVLTLVRPFKVPKIAGNNAMKQKLMM
FCKKEFEIDERFERYLLQKHEVLFIEIRCVRLDAFENRDKAKRENFKQQWPNKGWFSFNY
RHGREFVIPHNLNTAQNPVDDLTLAGIGVERARRDEDIFDVSAEVKVNTNFVEISQFDDD
HTYACAVYVTKRVNIPDIYKHIRCNKMNSIFESYENLKRRVYLNEYFWKETINLRCPISN
SRIKFMQLIIEQVNILYPLDFNLNILPRPEVIKILQREINSGETEYKDIDKNDLKTCTLE
SDLSVKIGCRTFILDDTQEPNQMIEFRADDPKSMKISKTNLCVLGQFRKDYRQKQRNDLK
RGFSLPSRSQSQFSQISQSQSLYLSPSQLLPQKDQQDYILSEMSKMPEYQKEEKEK