Identifiers and Description

Gene Model Identifier

Contig12769.0.g60

Standard Name

PHD15

Aliases

Contig12769_0_g60

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12769.0.g60(coding)
ATGGATTAATAGTAGTAACATAGTGAACTTCACTTGGAGTCTTATTAATTCTCTGCTCCA
TCTCTCATTAATAATTTGGTAAATAATTAGCAAACCATTCCAACGGTGGTCATCAGATTT
CCAGAGGAGCAGCCTTAATCTTAGCCCAATCAATAACCGCAAAATCATCTAGGCTTTATG
AATACATGGAGAGAGAACAGACTCATTAAAACTTTAAATTTAAATCTATTTTTCATTCAA
ATAGCCTTGAGTTTGTTCAATTGCTTGCTAATCATATTAACAATCGATGAAATCTGGACT
CTAAGCCCTTCTAGTAAATTTGCCATTGGCTAAACAGCAGTCCTGTTAACTCATGTTATT
TTAAGCTTAATATCACTAACATCCCTAATATTCACAGAAAAAGCAGCTTCAACTCTGAGA
GATAAACTTGAGAAAATTCTTGGAATTAAAGATTCATCGTAACAAACATCATTGAATTCT
GTACATCTACAAAAATTGTACAGATTGATCTGCTAAACTTTTCCAGATGAGGAAAGAGCG
AAAGAGATTCTTTACCGATTTCTAGCTATATATGGAGGAAATCTCTTTTTAGTTTTATTT
AAGCCAATAATATTTGTCATTGCAGTGGTTATAATGATGTGGTAATATGAAGATAATGTA
AATGATCCTTAAAGGAACCCAAACATTTCAAGAGATCCATCTTACCTGGATCAAAGAATG
GATGACTTGAGAAAAATTTAATATTAAAAAGCCTTGAAATTTGTATAATAAATACTGACA
ACATGGAGTAAACCAATTCAAAAAGTTAAAAAAGCAATTCAACAAATTGACATTCAAAAT
TTGGAAAATGGCCAATCTGATTAGTAAGAATAAGTAATAGAGTGTGCGATTTGCCAAGAA
AAGCTTCTCTAGATAGAAGTATGTGACATAGTAAAAGATTTATCATAATCAAGCATTGAG
CAAAGTTTCGAATAATTGAATGCAACAGATAAGGAAAATAGAGTTAGTACGCAGCGGATA
AAACGATAATCACTTGATAGTAGCAGTAGTAAATAGGTTATCTAGTTGAAATGCAATCCT
AAACATGTATTTCATACTGATTGTATCAAACAATGGCTTGAGCAAGAATCCAAAAATAAC
AATCACTAAACTTGCCCACTATGCCGAAGTGATTTGGCATAAGTTTTTAAGAAATATAAG
CATGATAAAGAACAGAGAAGATAGAAAAAATTGGAAAAGATACAGAACAAGTCTCATTTG
AAAAAGTAGCTTAGTCTATACGATATTGAGGGTTAAGGAAATGTTAAGAAGATAAAATAA
CTGCCACTTTATGATGTTAATGATTTAGTCAGGTTGCCTTTTGAAAATAATCAATCAATT
TCTATAGTAAAGCGTAAAAGTAGGAAGAACAACAAAAACCCTCAAAATAGACAGCAATAA
ATTCAGCATGTAAAAAGAAACAAAATATCATAAAATCAGCAAAATGATATAAGCGTGGAA
AGTTATAGTAACTCCAATACTTCTACAAAGAAAGAAAGAATTCAGAGAAACTGTGCGAAT
ATTCTAAATGTAGTTTCTTAATTTAGTGGGGGTGGAAATGGATTCAGCTAGAATACTGCA
TTCCCAGACAATAATAATGGATTTCAAAATACTAATCCTTTTAAGACTCATATGAAAAAG
TAGAGTTCATTTAAAATCGATTATAATTAAGAATAGAATGACGATGAAATTTTTAATAGG
AGTCAAAGTTAACTGCTTTTATAAAAGGATTAGAAATATGAACTTTTTATTAGCCCTTTA
GAGGGTATTAAGAGAGATAACTAAATTGGTCTTTAACAAAAATTAAAAGAATCTTTAAGA
CAAATAAGTGAAGAAAGTAAGCGAGATTATCCTTTGAATTAACAGAGAAATACTTATACT
AAGAAGCATTCAATATGGGATTAAGAAATTGAGATATAGCCCATTAATGAGTACATTTAA
GACTCCAGTAATACTTAAAATAAAAATGCAAATCCGAACTATCTCAGTTACAAGAAAAAG
CCTCAGTAAAACACTTAAAATTCTTCTGTTAATGAAAACCTATCCTCCTAAAATTCTTAA
TAAGAGCAGGAAGAGGAGGACTCAACAAGAAATTACTAAGACGCCAGTAGTAGGCGATAG
TTGAGATAATAGAGCAAAAGATAATCTATTGATAAACAAATCGGGTTTAGCAATAGAGTA
CAAAAATTATAATAAAACAGTCATAAGAGTTAATTAGAAATATAGTAGGATGAAAAGTTT
GACAAGGAGAACTCTGGCGTATTGCTGATATCTGGTGGTAATTTGATTACATTTTAGTAG
TTGCAGATATAAGATGAGGATATTGAAGAATATAAAGATGAATGA


>Contig12769.0.g60(protein)
MDQQQQHSELHLESYQFSAPSLINNLVNNQQTIPTVVIRFPEEQPQSQPNQQPQNHLGFM
NTWRENRLIKTLNLNLFFIQIALSLFNCLLIILTIDEIWTLSPSSKFAIGQTAVLLTHVI
LSLISLTSLIFTEKAASTLRDKLEKILGIKDSSQQTSLNSVHLQKLYRLICQTFPDEERA
KEILYRFLAIYGGNLFLVLFKPIIFVIAVVIMMWQYEDNVNDPQRNPNISRDPSYLDQRM
DDLRKIQYQKALKFVQQILTTWSKPIQKVKKAIQQIDIQNLENGQSDQQEQVIECAICQE
KLLQIEVCDIVKDLSQSSIEQSFEQLNATDKENRVSTQRIKRQSLDSSSSKQVIQLKCNP
KHVFHTDCIKQWLEQESKNNNHQTCPLCRSDLAQVFKKYKHDKEQRRQKKLEKIQNKSHL
KKQLSLYDIEGQGNVKKIKQLPLYDVNDLVRLPFENNQSISIVKRKSRKNNKNPQNRQQQ
IQHVKRNKISQNQQNDISVESYSNSNTSTKKERIQRNCANILNVVSQFSGGGNGFSQNTA
FPDNNNGFQNTNPFKTHMKKQSSFKIDYNQEQNDDEIFNRSQSQLLLQKDQKYELFISPL
EGIKRDNQIGLQQKLKESLRQISEESKRDYPLNQQRNTYTKKHSIWDQEIEIQPINEYIQ
DSSNTQNKNANPNYLSYKKKPQQNTQNSSVNENLSSQNSQQEQEEEDSTRNYQDASSRRQ
LRQQSKRQSIDKQIGFSNRVQKLQQNSHKSQLEIQQDEKFDKENSGVLLISGGNLITFQQ
LQIQDEDIEEYKDE