Identifiers and Description

Gene Model Identifier

Contig20447.0.g86

Standard Name

PHD11

Aliases

Contig20447_0_g86

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004446000.000000000008998169033602767hypothetical protein
SGDYOL013C0.0000899730839127287HRD1 SGDID:S000005373, Chr XV
from 303035-301380, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20447.0.g86(coding)
ATGCCCGAGTAGATTAAGCAAGAATTTCAAGCCAAAACCGCTGAACTTAGAAAAATGATG
AATAGCTCATCCAACTAATCGAATAATGAAACCAGGGGAGGTTATGCAAATTCAACGAAT
GGCGGTAGAAAAAGAGCAAATACAGCTAGTATTGGATCTGCTGCATCCATATCTTAGTAG
CACAATTCTCTTTCCACAAATAGTAACTCAAGGAAATCTCAAGTGGGAAACTCAAATTAG
AAGAATATCTACCAGGGTATTAAAATAGAGAACGATCCACTCGAGAGAGAAATTTATGTG
AAGTGCCCTCTATGCTCGCATAAAGTATTCGATTCTGGTCTGGAAAATTAGCTACAATGC
GATGGCTGCAACTTTATTTTTGAAAGCGGAAAAGCATACAATGAACAGTAGATTAGACAG
TTGAGACAAAGATAAATGCGGATGGCACCCGATAACAACGACGATGAAGAAGACAACGAG
GAAGATGAGGATGACAATTAAGCAGATGATGAGGAAGAGAACGATGAAGAGGAGGAGTTA
GATAGAGACAACTCGGATGATTACCACAGTGGCAGTCATCACTCTGACAAAAGAGATGAT
GATAACCCCTTTACTTAAACACCAGACCCATCAGATTCCAAAGCCAAAATATCTGATAAA
AAGCAACACCAATCCAACCAAAAATCTTAGAAGAAGAGCATCAATGTAGTAGAGCAAAAC
GAAGTTGATGAGGAAGAGAAGAAAAGTTACGAAATTTTAAATCCATAGAAGGACAGTTAA
TTAAAGAATTGCAAAACACCCAATCGTAAATCAGAATTACAAATTAATTAAGCAAGCTCT
AACTCTAAGAAGCCCTCCCCATATTAATTGAATGTCCACTCACCAAATCCCAATCATCAT
GGATCAGGATCATCTTCACAAAGCAACAATAGACCAAACTAAAGACATTCAGTATCTGGT
GTCACGCACAATTAATAATTAGACAGTTCATCTAAATATGTGAATGAACTTGAAGATGTA
GTCTTGTTCTGTAACAAAGACACCATAATCTAAGATTTCAAAGATAATTCATCACAAGGA
GCAAATTTAAGTTTGATATAAAACCAACTTCTGATGCCATTTTTCCAGTTGAGAGCTAGA
ATATTGGAAAAGGGAACTTATTTCAAAATTGGTGATATAGAATTCTATGTGGCCGCATGC
GAACCATATGAGTTTGGGAAAGTCACCAGTAAATCTATCATAAGATGTACTTATTCTGTA
TCCAAGTCAGACGTGCTCCAAAGAATCAATTTAGTACCGTTAAGAAGGTTGGATAATTCA
AGAACAGCTATTATGGATACAGCTATCAAGCCATTTTTAGAGTAAAACCCTGAATTTTAC
GTTCATAAAAATTAAATACTTGAGTTTGAGGACTACGAATTCTACGTGAAGTATTCAAGA
CCATTCTTTGGGAGAGTTGATCATACATCAACTGAAATCAAAATTGATTCATCTACCCCT
AAACCTGTTTAAGTAATGAGAATTGCACCGATTTGGGAAGATGATGCTTAGCATGAATAA
GCCAATAGTAATAAGGAGCATACTTTTGAATATCTGAAAGCTAACTACTTGCACCCATAT
TTCTACTGCGGTTTCATGTGTTACGTAGAAAAGGGCGAGACTATCCTTATTGATAATCAA
GAATTCTTTGTCAACGACTGCAGACCAAAATGTGGTATTATTGACAAGTAGACTATTATC
GAAATGGAAGTTGGTTTTACTAAGGAAGTGTTCAAGAAGAAGCAGGTTCTTGCAGATTAG
AGATTTGCTGAAAAGATTCAGAGTAGGGATGGCAGTTCTGGTGTAGCTGGTCTTAGTGCT
CTGACAAGTAGCTCTAGTTAAAGACATAGACATGGCCACAGCAGTTCGCAATACTAAAGA
CAGCTGGAAGAGCTAGAGGGACTCGAAGGACTTCTTGGCATGACGAATAATAGTGCATAA
GCTATCAATCAAAATCTGATGGAAATCTATGGCTAAATGAGAAGATAGTAGTCGCAGAGA
GCAAGCTCCAATACTGGATCATCTGGCAATGTGCAATCGCTTCGTAGATCAGCCATTGAA
TTGTTAATGACAAACGACAGGAGTGCTCATGACAACGAATACTAAGCAATAGTCAGAGAA
ATGTTGATTTAATAGGCTTAGATGCATAGATATGGTGGTTCAAGCTCTTCAAGTTCTAAC
CAAAGATCTAGCAATGTCACACCAAAATAAATTGTGCAAGCCTTGCCAGAGAGACTGATA
ACCAAGGAGTTCTTGATGAAGCAAGAAGATGAATCCAACAAGAAATGTCTGATTTGCCAA
ATGGAGTATGAAGATGGTGAGAATGTGAGAACTATGCCCTGCTTACATTTCTTCCACACC
GATTGCATCGATAAATGGCTGCTCTCAAGAAGCAGAACATGCCCTATTTGCAAGTTTGAT
ATTAAAAGAAACTACAATCAATCAGTCCCAAAAAACTGA


>Contig20447.0.g86(protein)
MPEQIKQEFQAKTAELRKMMNSSSNQSNNETRGGYANSTNGGRKRANTASIGSAASISQQ
HNSLSTNSNSRKSQVGNSNQKNIYQGIKIENDPLEREIYVKCPLCSHKVFDSGLENQLQC
DGCNFIFESGKAYNEQQIRQLRQRQMRMAPDNNDDEEDNEEDEDDNQADDEEENDEEEEL
DRDNSDDYHSGSHHSDKRDDDNPFTQTPDPSDSKAKISDKKQHQSNQKSQKKSINVVEQN
EVDEEEKKSYEILNPQKDSQLKNCKTPNRKSELQINQASSNSKKPSPYQLNVHSPNPNHH
GSGSSSQSNNRPNQRHSVSGVTHNQQLDSSSKYVNELEDVVLFCNKDTIIQDFKDNSSQG
ANLSLIQNQLLMPFFQLRARILEKGTYFKIGDIEFYVAACEPYEFGKVTSKSIIRCTYSV
SKSDVLQRINLVPLRRLDNSRTAIMDTAIKPFLEQNPEFYVHKNQILEFEDYEFYVKYSR
PFFGRVDHTSTEIKIDSSTPKPVQVMRIAPIWEDDAQHEQANSNKEHTFEYLKANYLHPY
FYCGFMCYVEKGETILIDNQEFFVNDCRPKCGIIDKQTIIEMEVGFTKEVFKKKQVLADQ
RFAEKIQSRDGSSGVAGLSALTSSSSQRHRHGHSSSQYQRQLEELEGLEGLLGMTNNSAQ
AINQNLMEIYGQMRRQQSQRASSNTGSSGNVQSLRRSAIELLMTNDRSAHDNEYQAIVRE
MLIQQAQMHRYGGSSSSSSNQRSSNVTPKQIVQALPERLITKEFLMKQEDESNKKCLICQ
MEYEDGENVRTMPCLHFFHTDCIDKWLLSRSRTCPICKFDIKRNYNQSVPKN