Identifiers and Description

Gene Model Identifier

Contig6835.0.g65

Standard Name

PHD1

Aliases

Contig6835_0_g65

Description

PHD-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001283200.000000000000020000882446601127hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6835.0.g65(coding)
ATGGTAAACAAGGCAAGATTAAGCAGAAAAACGAATTCCAGGGATTTGGAAAGTGAGATG
ATGGTGGGCGTATACACTTCTGATGTGGTTGCCTCAAAAGCAGCAAATGAGAGCCCCTTC
CAGCTGCCTCCAACAAAGAGACAGAGAACATCGAGTTACATCCCCGACAACTTCGTTCCT
CTTTCACTCAAGAAAGAGCAGAACCTCGAAGATGCTGAGAATAAGCTGGAGAATGATTCA
GATGATGAACTCCTAATTTTAACTTCTTCACCATTACAAAGTAGTAATGATTCTCAAAAG
CTTGTGACTGACAGCATCAACTCAAACCAAGTATCAGAAAGCAAAGGAAGCAAATCTCCA
TCCACTTCTGTTAGCCAACCAACTGACGAGAAGAATCTCAGCAACCGCAGCTTAGGCTAC
TCATCACAAACCAAAGATCAGTAACTCAAGTAATCCAGCAAATCCCACCAGACTTCCAAG
GCGGCAACTCAGCCAAGAGGAGGTCCCCTTATTTGGTCAACCGAAAGCGGCAAGAGCAAC
ACCGAGTGCCAGACCACCGATTCCAAGAAAATGGGGCACAGTGAAAATTTATCAGTTTTC
AATGATGATCAGGGCCAAGTGAACGATTTTAACAGTGCTGAGACCCTAAACAACAAGTTG
GAATAGAAATAAGTTATCAATTAGAAATAATCAAATAAAATTCATTCAAAAAAAGCCAAG
CTTAAAACTCTCTAAAAATCAACAGCTCAATCCCAAAAGAACAAGAAACAAAACAGAGTA
AGCAACTTGGCTAGCAACCCAAATGCACATGGGTTCCTTCTTCTGCTCAAGGCACTTGAC
TTGGTTGAGTATGAGTGCTGGAAAGAGGAAACTATTCGTAATTCGGAGTTGTTTATGGGG
AAATTTCAACAGCATTCAGGTGAGGAGATGAGTGATGAAAGCGCATCCAAGTCTCGAGTG
ATGAGCTAAGATTCGTCAGATTAAGATCAGCTTATGAAAGATCAAGATGAATCCCATGCT
CACAATCACACAATGCCACCACAAAGTATGCTTGATGACTCTCAAATGATTTGCCCAATC
ACAATTAACCCTAACAATCCTATCAAGGATCCAATTACAAAAAAGAGAATCAGAATGTGT
GCAAACAGGTTTTGCTGCAACCCTAACAAAAATCCCACCGACTACAAAGGTTGGTCAAGG
AGAAAGCTAAACAAAAGTGGTTAGTTTATGTGGCTTTGCGATCTTTGCTCATAAGCATTC
AAGAATAACTAGTACTGCACAGCTTGCTACTAGATTTATCTAGACTCTGGTGACTATGCA
GAAACTGATGGCAAAGAATGGGTCCAATGCGAGAACTGTAATAAATGGGAGCACACAGAT
TGTGAAGTTATAAATGGCTTTACTGAACTTCCAGAGAAACTGTAATAAGATGGGTGGAAA
TATTTCTGCCCACTCTGTAGAAAGAAAAAGCCTTTAATTTAATCTACTGAAGTCTCTAGC
AACGACCCAAATGAGACCAAGATTTCCCTAATTGAATCAATTCCTGTATTTAGCGCTGAT
CAATTAAACCAAGATTAGATAGAACCAAATAAGATAGATTTTGATTCTAAAGATTTTGAC
AAGATCCTCTCTGATCTTACTTCCACTCAAAAACAAGCAAACAATTCAAGTACTAAGAGA
ATTTCAAGGCAAAAGCAACCTAATCTTCAGACTGACTTAGATTCTATAAAGTCAGATTCA
CTGAAAAAGGGAAGCTTGAAGACTAGAAGCTCAAACTAAGAGAGATTAAATCATGGTACC
AAAAGTCTAAATAAAGTAGATTTATCATCTGCTCTTGAAAGTCATTTCTAAGAGAACTCT
AAGTCTTCATCCACTCCAACTCATCAAACAAATTCAGAGAAATAAACTGATAGTTTTGCC
TAAGTAATTGCTAGATCACAAATGACAACTAGACATGGTAAAGCTTCAGTCACTGCATCC
AAGAAACTCTGA


>Contig6835.0.g65(protein)
MVNKARLSRKTNSRDLESEMMVGVYTSDVVASKAANESPFQLPPTKRQRTSSYIPDNFVP
LSLKKEQNLEDAENKLENDSDDELLILTSSPLQSSNDSQKLVTDSINSNQVSESKGSKSP
STSVSQPTDEKNLSNRSLGYSSQTKDQQLKQSSKSHQTSKAATQPRGGPLIWSTESGKSN
TECQTTDSKKMGHSENLSVFNDDQGQVNDFNSAETLNNKLEQKQVINQKQSNKIHSKKAK
LKTLQKSTAQSQKNKKQNRVSNLASNPNAHGFLLLLKALDLVEYECWKEETIRNSELFMG
KFQQHSGEEMSDESASKSRVMSQDSSDQDQLMKDQDESHAHNHTMPPQSMLDDSQMICPI
TINPNNPIKDPITKKRIRMCANRFCCNPNKNPTDYKGWSRRKLNKSGQFMWLCDLCSQAF
KNNQYCTACYQIYLDSGDYAETDGKEWVQCENCNKWEHTDCEVINGFTELPEKLQQDGWK
YFCPLCRKKKPLIQSTEVSSNDPNETKISLIESIPVFSADQLNQDQIEPNKIDFDSKDFD
KILSDLTSTQKQANNSSTKRISRQKQPNLQTDLDSIKSDSLKKGSLKTRSSNQERLNHGT
KSLNKVDLSSALESHFQENSKSSSTPTHQTNSEKQTDSFAQVIARSQMTTRHGKASVTAS
KKL