Identifiers and Description

Gene Model Identifier

Contig21668.0.g26

Standard Name

PHAXb

Aliases

Contig21668_0_g26

Description

PHAX RNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21668.0.g26(coding)
ATGAAAACTCACTAGACAACTTAACCACTCCCTAAGAGAGTTACAGATTTAAACATACAA
ACCATTTGTAGTAAACTTTCACTCATGAAAACAGATTAATTTGAGAGTGAACTCACCAAC
ATACTCAGAGAACCCAAGAGATATCTGATTCACTCAGTTGTTAAATATGTAGCCAAGGAT
TTGATCTTAAAAGTATTAGTACAAACCATAGAAATATAATATCAAGGTGGGATGAAAGTT
CAAGGGGACGATGAAAAATAGAAAACCCCAGGTGGCGTTTTTCTCACGCTTTTAAAGAAA
TCTAAAGAAGTCCCAGATGATATCATGAAAAGAATTAAAAACTTGGAGAAGTAATAATCC
AAAGATAAACGCCGTACGCTTAAAATGATGAGTTCCCTAAATATCGATAAAATTAAAATA
CCTCATAGTCTCAGTTAAAGTCTATGTGAGTTGCCACAATTATCATGCGAATTGATTGAT
ACTTAAATGTCTGAAATCACAAATAGCAATAACTAATAGCAGACCTTGCCATCAGAATTA
AATGTGATTTTATAAAACGAATAGTAGAATACTACTAATTAAAAAACATCCAATGGTATA
TAAAAGAGGGAAAGACTTAAATTGGATTGA


>Contig21668.0.g26(protein)
MKTHQTTQPLPKRVTDLNIQTICSKLSLMKTDQFESELTNILREPKRYLIHSVVKYVAKD
LILKVLVQTIEIQYQGGMKVQGDDEKQKTPGGVFLTLLKKSKEVPDDIMKRIKNLEKQQS
KDKRRTLKMMSSLNIDKIKIPHSLSQSLCELPQLSCELIDTQMSEITNSNNQQQTLPSEL
NVILQNEQQNTTNQKTSNGIQKRERLKLD