Identifiers and Description

Gene Model Identifier

Contig12487.0.g48

Standard Name

PHAXa

Aliases

Contig12487_0_g48

Description

PHAX RNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam10258 ) PHAX RNA-binding domain
  • ( pfam09969 ) Uncharacterized conserved protein (DUF2203)
  • ( pfam12026 ) Domain of unknown function (DUF3513)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12487.0.g48(coding)
ATGTTATCGAAACCCATGAAATAACAACCAGAAGACATACACATATAAGTTTCTTAATAA
AAAGAAAGCATTTTAAGTACAAGTAATACTTTACCTGATTAATAAAACATAGTAAAATAA
AAAGAAACTAAAAATAATGAAAAAATAGAAAAAACTAAGAAACTCGAGAACAAATAAAAG
CTGCCAGATAGCTTGATAATTTAATTGAGAAAAGCATCAAAATTAGTCAGGATTGGTGAC
TAAATTACTGGTGATGATAAGATAAAGCTTTTGGATATTACACAGACCAATGATTAGTAG
TTTGTAAAGTATATTTGTGATAGACTCAAAGAGAGAAATATCTAACTATACCATAAGCTA
GTTAAACTTCTAGGCAGAGACCAATCTATTGTAATATTTAACAAAGTAGCTGAGATTTAA
TCATCATCTGATGGATAGCGAATTACAATCGATTACAAGCGTCCTGGTGACAATAAACCT
TGTAAATTCGAGGGGTATAAACAACCAGGAGGAGTGTTTATTCAATTGATTAAGGATGAA
TACCCAAGCGAAGTGTGGAAGAAAGTGCTTAATGATGATAAAAAGTGGGGAAAAAAGAGC
AAAGAAATCAATAAATAAATGGAAAAGATGGCTATTGGCTTCAAATGA


>Contig12487.0.g48(protein)
MLSKPMKQQPEDIHIQVSQQKESILSTSNTLPDQQNIVKQKETKNNEKIEKTKKLENKQK
LPDSLIIQLRKASKLVRIGDQITGDDKIKLLDITQTNDQQFVKYICDRLKERNIQLYHKL
VKLLGRDQSIVIFNKVAEIQSSSDGQRITIDYKRPGDNKPCKFEGYKQPGGVFIQLIKDE
YPSEVWKKVLNDDKKWGKKSKEINKQMEKMAIGFK